Recombinant Vanderwaltozyma polyspora Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; Kpol_1025p44; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
GET1
Target Protein Sequence
MNWVIIAALFFVIINKLLQYTSRYQEAWINKFSISSDISSLSKEYSKLSAERLKIKEENQ SISAQDNYARWTKNNRKLTKLEGELEKLRSNLKIAKDSQSKLFNRLKLLTLTLPFMILKL WKGKFIVYDIPTKDTFPVIVNGVLSQGLLYIPLLPINFLRGIDPNKHILVPGVSLGIWLM ALTKTIDTVEFIVKQLVFQPVVSKQVKEKTKEKVVELKTTEAELD
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of GET1 protein in cellular traffic?

GET1 (Golgi to ER traffic protein 1) serves as an essential component in the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. As part of the GET complex, it functions together with GET2 as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The complete GET complex also cooperates with the HDEL receptor ERD2 to facilitate ATP-dependent retrieval of resident ER proteins containing a C-terminal H-D-E-L retention signal from the Golgi back to the ER . This protein trafficking mechanism is critical for maintaining proper organelle composition and cellular homeostasis, making GET1 a significant protein for studying intracellular transport pathways.

How is recombinant Vanderwaltozyma polyspora GET1 typically expressed and purified?

Recombinant Vanderwaltozyma polyspora GET1 is typically expressed with terminal tags to facilitate purification and detection. According to available product information, these recombinant proteins often contain an N-terminal tag and may additionally feature a C-terminal tag, with tag types selected based on various factors including tag-protein stability considerations . The purification process generally involves affinity chromatography leveraging these tags, followed by additional purification steps as needed. When working with this protein, researchers should verify the specific tag configuration and purification strategy employed, as these can influence protein functionality and experimental outcomes.

What are the key structural features of GET1 that influence its functionality?

GET1 contains multiple transmembrane segments (specifically three transmembrane domains labeled TM1-3) that are crucial for its function in the GET complex . These transmembrane domains are particularly important as they mediate complex formation with GET2, creating the functional receptor for GET3-bound TA proteins. Studies have shown that mutations in these transmembrane domains can disrupt TA protein insertion, highlighting their critical role in the function of the GET pathway . Additionally, the cytosolic domains of GET1 interact with GET3 and are essential for the proper functioning of the complex. Understanding these structural features is fundamental for designing experiments to investigate GET1 function and for interpreting results from structure-function studies.

How can I design experiments to assess GET1-GET2 complex formation efficiency?

To assess GET1-GET2 complex formation efficiency, researchers can employ multiple complementary approaches:

  • Biochemical reconstitution: Create a single-chain version of the Get1/2 heterodimer (Get2-1sc) using a linker sequence such as ASGAGGSEGGGSEGGTSGAT to connect the proteins . This construct can then be expressed and purified for in vitro studies of complex formation and function.

  • Cysteine cross-linking assays: Introduce cysteine mutations at specific positions in GET1 and GET2 using overlap extension PCR (OE-PCR) techniques. These cysteine pairs can then be used to assess proximity and interaction through disulfide bond formation under oxidizing conditions .

  • Functional reporter assays: Develop cell-based reporters that monitor TA protein insertion efficiency as a proxy for GET1/2 complex functionality. Changes in insertion efficiency following mutations can provide insights into complex formation.

The experimental design should include appropriate controls, such as wild-type proteins and non-interacting mutants, to validate the specificity of the observed interactions. Data analysis should account for potential artifacts arising from the experimental conditions and should include statistical assessment of reproducibility across multiple experiments.

What are the recommended methods for analyzing GET1-mediated protein trafficking in live cells?

Analysis of GET1-mediated protein trafficking in live cells requires sophisticated approaches that combine molecular biology techniques with advanced imaging:

  • Fluorescent protein tagging: Engineer GET1 and/or its substrate TA proteins with fluorescent tags (e.g., GFP variants) that don't disrupt function. This allows for real-time visualization of trafficking events.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can measure the mobility and exchange rates of GET1 between different cellular compartments, providing insights into its dynamics.

  • Pulse-chase assays: Combine with fluorescent labeling to track the temporal progression of TA protein insertion and trafficking.

  • Quantitative image analysis: Employ automated image analysis algorithms to quantify colocalization, trafficking rates, and protein distribution patterns.

When designing these experiments, researchers should carefully consider the potential impact of fluorescent tags on protein function and localization. Control experiments should include known GET pathway substrates and inhibitors to validate the specificity of the observed trafficking events. Data should be collected across multiple cells and experimental replicates to ensure statistical significance.

How can I optimize expression conditions for recombinant GET1 protein to maximize yield and functionality?

Optimizing expression conditions for recombinant GET1 requires systematic testing of multiple parameters:

After expression, purification protocols should be optimized to include appropriate detergents that maintain the native structure of transmembrane segments. Functionality assays should be performed to ensure that the optimized conditions produce properly folded, functional protein.

How do mutations in the GET1 transmembrane domain affect its interaction with GET2 and subsequent TA protein insertion?

Research has demonstrated that the transmembrane domain of GET1 plays a critical role in its interaction with GET2 and the subsequent insertion of TA proteins into the ER membrane. Specific mutations in the transmembrane segments can disrupt these functions in several ways:

  • Complex formation disruption: Mutations in the six transmembrane segments (GET1 TM1-3 and GET2 TM1-3) can prevent proper heterodimer formation, even if the cytosolic domains remain functional .

  • Insertion mechanism alteration: Studies using cell reporters and biochemical reconstitution have defined specific mutations that disrupt TA protein insertion without completely abolishing GET1-GET2 interaction .

  • Engineered single-chain constructs: To avoid the potential for complex disruption by mutations in multiple transmembrane segments, researchers have developed a single-chain version of the GET1/2 heterodimer (Get2-1sc) expressed from the endogenous locus .

The experimental approach to studying these effects typically combines mutagenesis, functional assays, and structural biology techniques. For instance, cysteine mutations can be introduced at strategic positions in the transmembrane domains to facilitate cross-linking studies and assess proximity relationships. The resulting data provides insights into the structural organization of the GET1/2 complex and how specific residues contribute to function.

What are the comparative differences in GET pathway components between Vanderwaltozyma polyspora and other yeast species?

The GET pathway components show both conservation and divergence across different yeast species, with Vanderwaltozyma polyspora exhibiting some notable characteristics:

SpeciesGET1 FeaturesGET Complex CharacteristicsEvolutionary Relationship
Vanderwaltozyma polysporaContains standard transmembrane domains but with species-specific sequence variationsForms functional complex with GET2/3Evolutionarily positioned between Saccharomyces and non-Saccharomyces yeasts
Saccharomyces cerevisiaeWell-characterized GET1 structureExtensively studied GET complex functionalityEvolutionarily distinct from V. polyspora
Lachancea speciesGET pathway present but less characterizedPresumed functional similarityDiverged prior to V. polyspora in the yeast phylogeny

Vanderwaltozyma polyspora's position in yeast phylogeny (as indicated by studies of its transposable elements and genome characteristics) suggests it may possess interesting adaptations in its GET pathway components . Comparative studies of GET1 across these species can provide insights into the evolution of protein trafficking mechanisms and how they adapt to different cellular environments. This comparative approach is particularly valuable for understanding the fundamental versus species-specific aspects of the GET pathway function.

How can recombination-based approaches be used to generate novel GET1 variants with enhanced or altered functionality?

Recombination-based approaches offer powerful tools for generating GET1 variants with potentially enhanced or altered functionality:

  • DNA shuffling and directed evolution: These techniques can generate libraries of GET1 variants through recombination of gene fragments, followed by selection for desired properties such as improved expression, stability, or altered substrate specificity.

  • Chimeric proteins: Creating chimeric proteins that combine domains from GET1 proteins of different species can reveal which regions confer species-specific properties versus conserved functions.

  • Algorithm-guided recombination: Recent advances in computational methods for identifying recombinants from unaligned sequences (as described in source ) can be adapted to design optimal recombination strategies for GET1 engineering.

When implementing these approaches, researchers should consider:

  • Establishing appropriate selection or screening systems that can identify variants with desired properties

  • Using structural information to guide recombination points that minimize disruption of essential domains

  • Implementing iterative rounds of diversification and selection to progressively enhance desired traits

The resulting libraries of GET1 variants can serve as valuable tools for understanding structure-function relationships and potentially developing variants with novel applications in biotechnology or synthetic biology.

What are the most effective methods for assessing the functionality of recombinant GET1 in vitro?

Several complementary approaches can be used to assess the functionality of recombinant GET1 in vitro:

  • Reconstituted membrane insertion assays: These assays measure the ability of purified GET1/2 complexes to facilitate the insertion of model TA proteins into liposomes or microsomes. The insertion can be monitored using protease protection assays, fluorescence-based approaches, or gel-shift assays.

  • Binding assays with GET3: Techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or pull-down assays can quantify the interaction between GET1 and GET3, with or without bound TA proteins.

  • ATPase stimulation assays: GET1 interaction with GET3 can modulate the ATPase activity of GET3, providing an indirect measure of functional interaction.

  • S-protein attachment assay: As described in the literature, mixing appropriately affinity-purified GET3 targeting complexes with S-protein in insertion buffer allows assessment of complex functionality .

Data analysis should include determination of binding constants, kinetic parameters, and comparison with wild-type or reference proteins. These assays can be combined with mutagenesis approaches to map functional regions of the protein and understand how specific residues contribute to activity.

How can I design experiments to investigate the role of GET1 in handling misfolded proteins under stress conditions?

Investigating GET1's role in handling misfolded proteins under stress conditions requires multi-faceted experimental approaches:

  • Stress induction protocols: Establish reproducible methods for inducing specific cellular stresses (e.g., heat shock, oxidative stress, ER stress) and monitoring their impact on GET1 function.

  • Quantitative proteomics: Use stable isotope labeling (SILAC) or tandem mass tag (TMT) approaches to identify and quantify changes in the GET1 interactome under stress conditions.

  • Genetic interaction studies: Combine GET1 mutations or deletions with mutations in stress response pathways to identify genetic interactions that suggest functional relationships.

  • Live-cell imaging of misfolded protein handling: Track the fate of model misfolded proteins in wild-type versus GET1-deficient cells under stress conditions.

The experimental design should include appropriate controls to distinguish GET1-specific effects from general stress responses. Time-course experiments can reveal the temporal dynamics of GET1's involvement in stress response. Data analysis should integrate multiple readouts to develop a comprehensive model of GET1's role in maintaining proteostasis during stress.

What techniques are available for studying the conformational changes in GET1 during the TA protein insertion cycle?

Several sophisticated biophysical and biochemical techniques can be employed to study conformational changes in GET1 during the TA protein insertion cycle:

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy: This approach can monitor distance changes between specific sites in the protein during the insertion cycle.

  • Single-molecule FRET (smFRET): By labeling specific sites in GET1 with appropriate fluorophore pairs, researchers can monitor distance changes at the single-molecule level, revealing conformational dynamics that might be obscured in ensemble measurements.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of GET1 that undergo changes in solvent accessibility during different stages of the insertion cycle.

  • Cysteine accessibility studies: Similar to approaches used in previous studies , strategically placed cysteine residues can be used as probes for conformational changes by monitoring their accessibility to sulfhydryl-reactive reagents.

  • Cryo-electron microscopy (cryo-EM): This technique can potentially capture different conformational states of the GET complex during the insertion cycle.

When designing these experiments, researchers should consider the transient nature of some conformational states and the potential need for strategies to trap these states for analysis. Integration of data from multiple techniques is typically necessary to develop a comprehensive model of the conformational cycle.

What are common challenges in expressing and purifying functional GET1, and how can they be addressed?

Researchers frequently encounter several challenges when working with GET1, a membrane protein with multiple transmembrane domains:

  • Protein aggregation and misfolding:

    • Challenge: As a membrane protein, GET1 can aggregate during expression, particularly at high levels.

    • Solution: Lower expression temperature (16-20°C), use specialized host strains designed for membrane proteins, and test different detergents for extraction and purification. Additionally, deglycosylation approaches similar to those used for other recombinant proteins may improve expression characteristics .

  • Low expression yields:

    • Challenge: Transmembrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host, test different promoter strengths, and consider fusion partners that enhance expression. Creating GET1 variants with fewer glycosylation sites can also improve yields, as demonstrated with other recombinant proteins .

  • Maintaining native conformation during purification:

    • Challenge: Detergent selection can affect protein conformation and functionality.

    • Solution: Screen multiple detergents and lipid additives to identify conditions that maintain native structure. Consider nanodiscs or liposome reconstitution for functional studies.

  • Assessing functionality:

    • Challenge: Determining if purified GET1 remains functional.

    • Solution: Develop robust activity assays, such as GET2 binding, GET3 interaction, or reconstituted TA protein insertion assays.

Systematic optimization of each stage of the expression and purification process, combined with careful functionality testing, is essential for obtaining high-quality GET1 protein for experimental use.

How can I troubleshoot inconsistent results in GET1-related protein trafficking assays?

Inconsistent results in GET1-related protein trafficking assays can stem from multiple sources. Here's a systematic approach to troubleshooting:

  • Cell line and culture condition variability:

    • Issue: Different cell states can affect trafficking dynamics.

    • Solution: Standardize culture conditions (density, passage number, media composition) and include positive controls in each experiment to normalize results.

  • Protein expression level variations:

    • Issue: Varying expression levels of GET1 or reporter constructs can affect trafficking kinetics.

    • Solution: Use inducible expression systems with careful titration of inducer, or create stable cell lines with consistent expression levels.

  • Assay timing and sensitivity:

    • Issue: The kinetics of trafficking events may require precise timing for observation.

    • Solution: Perform time-course experiments to identify optimal observation windows, and use sensitive detection methods appropriate for the abundance of the proteins being studied.

  • Technical variables in microscopy or biochemical assays:

    • Issue: Variations in image acquisition or biochemical preparations can introduce artifacts.

    • Solution: Standardize acquisition parameters, use automated analysis pipelines, and implement technical replicates.

  • Incomplete complex formation or functionality:

    • Issue: If GET1 doesn't properly interact with GET2/GET3, trafficking will be compromised.

    • Solution: Verify complex formation through co-immunoprecipitation or proximity labeling techniques before proceeding with trafficking assays.

Implementing a systematic quality control process and detailed documentation of experimental conditions can help identify sources of variability and lead to more consistent results.

What strategies can improve the specificity and efficiency of GET1 genetic manipulation in model organisms?

Improving the specificity and efficiency of GET1 genetic manipulation requires tailored approaches for different model organisms:

  • CRISPR-Cas9 optimization:

    • Strategy: Design multiple guide RNAs targeting different regions of the GET1 gene and empirically test their efficiency and specificity.

    • Enhancement: Implement modified Cas9 variants with higher specificity or use base editors for precise modifications without double-strand breaks.

  • Conditional expression systems:

    • Strategy: Implement tissue-specific or inducible promoters to control when and where GET1 modifications take effect.

    • Application: This approach is particularly valuable for studying GET1 in developmental contexts or when constitutive manipulation is lethal.

  • Single-chain construct implementation:

    • Strategy: As demonstrated in the literature, creating single-chain versions of the GET1/2 complex can facilitate functional studies while maintaining the native context .

    • Method: Use overlap extension PCR (OE-PCR) with carefully designed primers to create fusion constructs with appropriate linkers .

  • Marker selection strategies:

    • Strategy: Implement sophisticated selection schemes, such as those used in synthetic genetic analysis (SGA), to facilitate the construction of strains with multiple GET pathway modifications .

    • Benefit: This approach allows for efficient creation of strains carrying different combinations of mutations for epistasis analysis.

  • Genomic integration site selection:

    • Strategy: Target integration to specific genomic locations that permit stable expression without position effects.

    • Implementation: Use landing pad systems or recombinase-mediated cassette exchange for reproducible integration.

Each of these strategies should be validated with appropriate controls and combined with functional assays to ensure that the genetic manipulations produce the intended effects on GET1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.