Recombinant Vanderwaltozyma polyspora High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SHO1; Kpol_1045p21; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
SHO1
Target Protein Sequence
MIPSRANAKARRAGHHVRHSFGISNLVGDPFAISTISISMISWVITLGGSIASATDRESF PRFTWWGIAYQALLLFIMIVIYCYDLVDYYKGFISSGSGVAFIYNTNSATNLVYSNGARK AAASAGVILLSVINLIWVFYYGGDNASPTNRWIDSFSLRGIRPSAYEDALIRSLRRRSAV HSRNLQNAALERENLHLSTNLYNGVDQNQNYVSAVGLTGFENTNPNSTNSNFNSPYRDQQ NDEVISMQIRNPTDTLKTSNENVNTFVTESSNGNTETTMGDTLGLYSEFGDESFPYTARA LYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQLIEDDEGI
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of SHO1 protein in V. polyspora and how does it compare to SHO1 in other yeast species?

SHO1 is a four-transmembrane (TM) domain protein that functions as an osmosensor in the high osmolarity glycerol (HOG) pathway in yeast. Research indicates that SHO1 forms complex oligomeric structures with a dimers-of-trimers architecture . Specifically, SHO1 dimerizes at the TM1/TM4 interface and trimerizes at the TM2/TM3 interface, creating a planar oligomeric arrangement that is critical for its signaling functions .

How does the SHO1 protein function in the HOG pathway in V. polyspora?

SHO1 serves a dual role in the HOG pathway: as an osmosensor and as a scaffolding protein. When yeast cells encounter high external osmolarity, the SHO1 transmembrane domains undergo structural changes that initiate signal transduction . This activation triggers SHO1 binding to the cytoplasmic adaptor protein Ste50, which then leads to activation of the Hog1 MAP kinase cascade .

The pathway specifically involves the HKR1 sub-branch that activates Hog1 through the Ste20–Ste11–Pbs2–Hog1 kinase cascade . The SHO1 protein forms a multi-component signaling complex by binding to transmembrane proteins Opy2 and Hkr1 at the TM1/TM4 and TM2/TM3 interfaces, respectively . This complex integration enables the coordinated response to osmotic stress that allows the cell to adapt to high osmolarity conditions.

What expression patterns does SHO1 exhibit in V. polyspora under different environmental conditions?

While the search results don't provide specific information about SHO1 expression patterns in V. polyspora, we can infer its behavior based on related systems in yeast. Gene expression in V. polyspora can show variable patterns under different conditions, as evidenced by studies of other genes such as ALA1 and ALA2, which are expressed at different levels (with ALA1 showing approximately two-fold higher transcriptional efficiency than ALA2) .

For SHO1, expression is likely regulated in response to osmotic stress conditions. Methodologically, researchers can use quantitative RT-PCR with gene-specific primers to measure SHO1 mRNA levels under various osmotic conditions, similar to the approach used for studying ALA1 and ALA2 genes in V. polyspora . Western blotting with anti-SHO1 antibodies would provide protein-level expression data, complementing the transcriptional analysis.

What experimental approaches are most effective for studying the oligomerization dynamics of recombinant V. polyspora SHO1 protein?

For researchers investigating SHO1 oligomerization, a multi-faceted approach combining structural and functional analyses is recommended:

  • Crosslinking studies: Chemical crosslinking combined with mass spectrometry can identify interaction interfaces and oligomeric states of SHO1 . For example, using bifunctional crosslinkers with varying arm lengths can help determine spatial relationships between SHO1 monomers in the oligomeric complex.

  • Fluorescence resonance energy transfer (FRET): By tagging recombinant SHO1 with appropriate fluorophores, researchers can measure oligomerization dynamics in real-time and in response to osmotic changes.

  • Site-directed mutagenesis: Systematic mutation of residues at the TM1/TM4 and TM2/TM3 interfaces can reveal which amino acids are critical for dimerization and trimerization, respectively .

  • Native gel electrophoresis and size exclusion chromatography: These techniques can be used to characterize the native oligomeric states of the protein under different conditions.

  • Single-molecule techniques: Methods such as single-molecule FRET or atomic force microscopy can provide insights into the dynamics of oligomer formation and dissociation at the individual molecule level.

The combined data from these approaches will provide a comprehensive understanding of how SHO1 oligomerization relates to its osmosensing function.

How can researchers address contradictory data regarding SHO1's role as an osmosensor versus its scaffolding function in V. polyspora?

Contradictory data regarding SHO1's dual roles can be addressed through carefully designed experiments that separate these functions:

  • Domain-specific mutations: Create mutants that specifically disrupt either the osmosensing or scaffolding function. For example, mutations in the transmembrane domains might affect osmosensing while preserving scaffolding capabilities .

  • Chimeric proteins: Construct chimeras between SHO1 and other transmembrane proteins to determine which domains are necessary and sufficient for each function.

  • Temporal analysis: Employ time-resolved techniques to determine the sequence of events following osmotic shock. This can reveal whether structural changes in SHO1 (osmosensing) precede or follow protein complex assembly (scaffolding).

  • Co-immunoprecipitation under varying conditions: Test SHO1 interactions with pathway components like Ste50 under different osmotic conditions and time points to distinguish between constitutive scaffolding interactions and stress-induced associations .

  • In vitro reconstitution: Reconstitute components of the pathway in artificial membrane systems to test osmosensing capabilities independent of cellular context.

A systematic analysis of data from these experiments can help resolve contradictions by determining whether these functions occur simultaneously or sequentially, and whether they are mechanistically linked or independent processes.

What methodological approaches can overcome the challenges in purifying functional recombinant V. polyspora SHO1 protein for structural studies?

Purifying functional transmembrane proteins like SHO1 presents significant challenges. Researchers can employ these methodological approaches:

  • Optimization of expression systems:

    • Test various heterologous expression systems, including specialized yeast strains, insect cells, or mammalian cells

    • Consider using weaker promoters and lower temperatures to reduce aggregation

    • Design constructs with solubility-enhancing fusion partners (e.g., MBP, SUMO)

  • Membrane protein-specific purification strategies:

    • Use mild detergents for solubilization (e.g., DDM, LMNG)

    • Implement detergent screening to identify optimal conditions for SHO1 stability

    • Consider nanodiscs or amphipols for maintaining native-like membrane environments

    • Apply lipid-based reconstitution methods for functional studies

  • Quality control approaches:

    • Employ fluorescence-based thermostability assays to monitor protein folding

    • Use circular dichroism to confirm secondary structure integrity

    • Verify oligomeric state using analytical ultracentrifugation or light scattering

    • Confirm functionality through in vitro binding assays with known interaction partners like Ste50

  • Structural biology techniques:

    • Consider cryo-electron microscopy for structural determination without crystallization

    • For X-ray crystallography, screen multiple constructs with varying termini and loop regions

    • Use SAXS (small-angle X-ray scattering) for low-resolution structural information

    • Apply hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

Success will likely require iterative optimization of each step in the expression and purification workflow, with continuous functional validation to ensure the recombinant protein retains its native properties.

How can genetic manipulation techniques be optimized for studying SHO1 function in V. polyspora given the unique genomic characteristics of this yeast species?

V. polyspora presents unique genetic characteristics that require specialized approaches for effective genetic manipulation:

  • Genome-specific targeting strategies:

    • Design targeting constructs based on V. polyspora genomic sequences rather than those from model organisms like S. cerevisiae

    • Account for the whole-genome duplication event in V. polyspora's evolutionary history, which may complicate gene targeting due to sequence similarities

    • Implement CRISPR-Cas9 systems with guides specific to V. polyspora SHO1 sequences

  • Promoter and marker selection:

    • Test native V. polyspora promoters, as heterologous promoters may function differently (as seen with SpALA1 promoter in S. cerevisiae)

    • Consider expression strength differences - for example, in V. polyspora, ALA1 shows approximately two-fold higher transcriptional efficiency than ALA2

    • Develop and validate V. polyspora-specific selection markers

  • Functional complementation approaches:

    • Utilize cross-species complementation assays to verify gene function, similar to methods used for AlaRS genes

    • Create knockout strains and assess phenotypic rescue with wild-type and mutant SHO1 constructs

    • Implement regulated expression systems to study dosage effects

  • RNA interference and antisense strategies:

    • Develop RNA interference tools specific for V. polyspora

    • Design antisense oligonucleotides targeting SHO1 mRNA to achieve knockdown without complete gene deletion

Successful genetic manipulation will require careful validation of each technique in V. polyspora, as methods optimized for model yeasts may not transfer directly due to the unique genomic features of this species.

What experimental design would best elucidate the protein-protein interaction network of SHO1 in V. polyspora under varying osmotic conditions?

To comprehensively map the SHO1 interaction network across different osmotic conditions, a multi-layered experimental design is recommended:

  • Affinity purification-mass spectrometry (AP-MS) workflow:

    • Express epitope-tagged SHO1 in V. polyspora

    • Expose cells to various osmotic conditions (isotonic, hyperosmotic at different strengths, hypoosmotic)

    • Perform time-course sampling (0, 5, 15, 30, 60 minutes post-stress)

    • Use gentle crosslinking to capture transient interactions

    • Analyze by quantitative mass spectrometry to identify condition-specific interactions

  • Proximity-based labeling approaches:

    • Fuse SHO1 to enzymes like BioID or APEX2

    • Apply osmotic stress conditions followed by enzyme activation

    • Identify proteins in close proximity to SHO1 under each condition

    • Compare spatial interaction maps between conditions

  • Validation and characterization of interactions:

    • Perform reciprocal co-immunoprecipitation for key interactions

    • Use yeast two-hybrid or split-fluorescent protein assays for direct interactions

    • Map interaction domains using truncation and point mutations

  • Dynamic interaction visualization:

    • Create fluorescently-tagged versions of SHO1 and key interactors

    • Track protein relocalization and complex formation in live cells under osmotic stress

    • Measure interaction kinetics using techniques like fluorescence recovery after photobleaching (FRAP)

  • Network analysis:

    • Generate condition-specific interaction networks

    • Identify core and condition-specific interaction partners

    • Compare with known HOG pathway components from model yeasts

    • Predict functional consequences of network rewiring under different conditions

This comprehensive approach would reveal not just the components of the SHO1 interaction network but also how this network dynamically reconfigures in response to osmotic changes, providing insights into V. polyspora-specific adaptations in osmotic stress response.

How should researchers design recombinant expression constructs to optimize V. polyspora SHO1 yield and functionality?

Optimal design of expression constructs for V. polyspora SHO1 requires careful consideration of several factors:

  • Vector selection and design considerations:

    • Choose vectors with appropriate copy number (low-copy vectors like pRS315 can provide more stable expression for membrane proteins)

    • Select promoters based on expression needs (constitutive ADH promoter for high expression or native promoters for physiological levels)

    • Include appropriate purification tags (His6, FLAG, or GST) positioned to minimize interference with protein function

    • Consider including cleavable tags to remove them after purification

    • Design constructs with and without predicted signal sequences to test localization requirements

  • Codon optimization strategy:

    • Analyze the codon usage bias in V. polyspora

    • Optimize codons for expression host while preserving rare codons that might affect folding kinetics

    • Avoid excessive GC content and repetitive sequences

  • Expression host selection:

    • Test expression in both S. cerevisiae and V. polyspora

    • Consider specialized expression strains with enhanced membrane protein production capabilities

    • Evaluate heterologous systems like Pichia pastoris for higher yield

  • Construct validation:

    • Verify expression using Western blotting

    • Confirm membrane localization using fractionation or microscopy

    • Test functionality through complementation of SHO1 deletion strains

    • Assess protein quality using size exclusion chromatography to determine oligomeric state

Learning from the experience with AlaRS genes, where expression levels varied significantly between genes and were affected by promoter choice, researchers should generate multiple construct variants and systematically evaluate their expression and functionality .

What are the most reliable assays for measuring SHO1-mediated HOG pathway activation in V. polyspora?

To reliably measure SHO1-mediated HOG pathway activation in V. polyspora, researchers can employ these validated assays:

  • Hog1 phosphorylation analysis:

    • Western blotting with phospho-specific antibodies against Hog1

    • Quantitative time-course measurements following osmotic shock

    • Comparison between wild-type and SHO1 mutant strains

    • Control experiments with inhibitors of upstream kinases

  • Transcriptional reporter assays:

    • Construction of reporter strains containing HOG-responsive promoters (e.g., STL1, GPD1) driving expression of fluorescent proteins or luciferase

    • Measurement of reporter activity in response to osmotic stress

    • Time-resolved analysis to capture activation dynamics

    • Dose-response curves with varying osmolyte concentrations

  • Growth and viability assays:

    • Spot assays on media containing osmotic stressors (NaCl, sorbitol)

    • Growth curve analysis in liquid media with various osmolyte concentrations

    • Comparison of growth rates between wild-type and mutant strains

    • Recovery assays following acute osmotic shock

  • Direct measurement of SHO1-Ste50 interaction:

    • Co-immunoprecipitation assays following osmotic stress

    • FRET-based interaction assays in live cells

    • Split-luciferase complementation to detect protein-protein interactions

    • Measurement of interaction kinetics after osmotic shock

  • Glycerol accumulation measurement:

    • Enzymatic assays for intracellular glycerol determination

    • Metabolic labeling to track carbon flux into glycerol

    • Time-course analysis following osmotic stress

    • Correlation with HOG pathway activation markers

Combining multiple assay types provides the most comprehensive and reliable assessment of SHO1-mediated pathway activation, allowing researchers to distinguish between defects in sensing versus downstream signaling.

How does the SHO1 osmosensing mechanism in V. polyspora compare with other osmosensing systems in fungi and higher eukaryotes?

The SHO1 osmosensing mechanism in V. polyspora represents one of several distinct osmosensing strategies that have evolved across eukaryotes:

  • Comparison with other fungal osmosensors:

    • Unlike the SLN1-YPD1-SSK1 two-component system that acts as a negative regulator in yeast, SHO1 functions as a positive osmosensor in the HOG pathway

    • While SHO1 uses transmembrane domain structural changes for sensing, other fungal osmosensors like Msb2 use heavily glycosylated extracellular domains

    • The SHO1 oligomeric structure (dimers-of-trimers) appears to be a specialized adaptation for osmosensing that differs from typical receptor architectures

  • Comparison with mammalian osmosensing systems:

    • Mammalian osmosensing often involves ion channels (e.g., TRP channels) that respond directly to membrane stretch

    • The scaffold function of SHO1 parallels mammalian scaffold proteins like JIP1 in MAPK pathways, suggesting convergent evolution of signaling architectures

    • Unlike many mammalian receptors that undergo internalization upon activation, SHO1 appears to maintain its membrane localization during signaling

  • Evolutionary conservation analysis:

    • Core components of the HOG pathway are conserved across fungi, but regulatory mechanisms show species-specific adaptations

    • The four-TM domain structure of SHO1 represents a unique osmosensing solution compared to the more common two-TM or seven-TM receptors in other systems

    • V. polyspora's whole-genome duplication background provides a context where duplicate genes may have facilitated functional specialization

This comparative analysis highlights how different organisms have evolved varied solutions to osmosensing, with the SHO1 system representing a specialized adaptation in fungi that differs significantly from osmosensing mechanisms in higher eukaryotes.

What insights can gene duplication patterns in V. polyspora provide about the evolution of the SHO1 signaling system?

V. polyspora's evolutionary history of whole-genome duplication provides a valuable context for understanding the evolution of signaling systems like SHO1:

  • Lessons from other duplicated genes:

    • The evolution of V. polyspora's AlaRS genes demonstrates how duplicated genes can undergo subfunctionalization, with ALA1 and ALA2 specializing in cytoplasmic and mitochondrial functions respectively, whereas in other yeasts a single gene performs both functions

    • This pattern suggests that SHO1 and other signaling components might similarly have undergone functional specialization following duplication events

  • Subfunctionalization versus neofunctionalization:

    • Analysis should determine whether duplicated signaling components have divided ancestral functions (subfunctionalization) or acquired novel functions (neofunctionalization)

    • For example, if V. polyspora contains duplicated HOG pathway components, researchers should investigate whether they have specialized for different aspects of osmotic response or developed entirely new signaling roles

  • Retention patterns of duplicated genes:

    • Comparison of retention rates between different functional classes of genes can reveal selective pressures

    • Signaling proteins like SHO1 may show different retention patterns compared to metabolic enzymes or structural proteins

    • Analysis of synteny and sequence divergence can establish the timing and evolutionary trajectory of duplications

  • Methodological approach:

    • Comprehensive phylogenetic analysis of SHO1 and interacting proteins across Saccharomycetaceae species

    • Reconstruction of ancestral states to determine the original functions before duplication

    • Functional testing of orthologs from pre-duplication lineages to establish ancestral functions

    • Analysis of sequence evolution rates to identify regions under purifying or diversifying selection

The unique genomic history of V. polyspora, where contemporary AlaRS genes arose from duplication of a dual-functional predecessor of mitochondrial origin , suggests that similar evolutionary processes may have shaped its stress-response pathways, potentially leading to innovations in osmosensing mechanisms.

What are the most common pitfalls in working with recombinant V. polyspora SHO1 and how can researchers overcome them?

Researchers working with recombinant V. polyspora SHO1 should anticipate and address these common challenges:

  • Expression and solubility issues:

    • Problem: Low expression levels or formation of inclusion bodies

    • Solution: Optimize growth conditions (temperature, induction timing), use solubility-enhancing fusion tags, and test different expression hosts including specialized membrane protein expression strains

  • Protein mislocalization:

    • Problem: Failure of SHO1 to properly integrate into membranes

    • Solution: Verify signal sequence functionality in expression host, confirm membrane integration using fractionation studies, and consider homologous expression systems

  • Loss of oligomerization capability:

    • Problem: Recombinant SHO1 fails to form the native dimers-of-trimers architecture

    • Solution: Preserve native TM1/TM4 and TM2/TM3 interfaces by avoiding disruptive tags, maintain appropriate detergent concentrations, and validate oligomeric state using analytical techniques

  • Non-functional protein:

    • Problem: Loss of osmosensing or scaffolding functions

    • Solution: Validate protein functionality through binding studies with known interactors like Ste50, verify structural integrity via limited proteolysis, and confirm correct folding using spectroscopic methods

  • Species-specific expression constraints:

    • Problem: Promoters or regulatory elements functioning differently between species

    • Solution: Use native V. polyspora promoters when possible, as heterologous promoters may function differently (as observed with the SpALA1 promoter in S. cerevisiae)

  • Cross-contamination with endogenous proteins:

    • Problem: Co-purification of host proteins with similar properties

    • Solution: Design purification strategies with multiple orthogonal steps, validate protein identity by mass spectrometry, and consider using tagged constructs with high-specificity purification options

By anticipating these challenges and implementing appropriate strategies, researchers can significantly improve their success in working with this complex transmembrane protein.

How can researchers develop robust controls to validate the specificity of osmotic stress responses mediated by SHO1 in V. polyspora?

Developing robust experimental controls is critical for confirming the specificity of SHO1-mediated osmotic stress responses:

  • Genetic controls:

    • Generate SHO1 deletion strains as negative controls

    • Create point mutants that specifically disrupt osmosensing (TM domain mutations) or scaffolding (protein interaction interface mutations) functions

    • Develop complementation strains with wild-type SHO1 for rescue experiments

    • Include strains with mutations in other HOG pathway branches that operate independently of SHO1

  • Stimulus specificity controls:

    • Compare responses to osmotic stress (NaCl, sorbitol) versus other stressors (oxidative, temperature, pH)

    • Use osmolytes that cannot penetrate the membrane (sorbitol) versus those that can (glycerol) to distinguish membrane-based sensing

    • Apply gradual versus acute osmotic changes to test temporal sensitivity

    • Include non-activating control conditions (isotonic media with equivalent ionic strength)

  • Pathway specificity validation:

    • Monitor activation of multiple MAPK pathways (HOG, mating, cell wall integrity) to confirm specificity

    • Use inhibitors of specific pathway components to block signal transduction at different levels

    • Test for activation of HOG-specific versus general stress response genes

    • Implement phosphoproteomic analysis to identify specific versus non-specific phosphorylation events

  • Technical controls for protein-protein interactions:

    • Include non-interacting protein pairs as negative controls in co-IP experiments

    • Perform competition assays with excess untagged protein to confirm binding specificity

    • Use appropriate detergent controls when working with membrane proteins

    • Validate interactions using multiple orthogonal techniques (co-IP, FRET, split protein complementation)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.