Recombinant Vanderwaltozyma polyspora Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
IML2; Kpol_282p6; Inclusion body clearance protein IML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
IML2
Target Protein Sequence
MLRVFGSLTRSRSSSVLSQDDKIKQILKQAHDFEIALQAMDYVLDDRAEEGLALLKKNEA EDGSDQTINVLARGVIEFLEATLGFEAEEMKKASETLAKAENLSLKSRQYAQKNDLKSSS LYAPGTVYAVTYTESCLLHALLMIFSESYVETAKALLKLRKAYYMLQEIFEEMKKVKQTN GNMSIYKSETNHSEASVDSSNASFSSVDIPYELTREESNNSLYQESAEKVQKMRVRRLTG SHIGNTPAIDRLRSELGLDGPKVTTEENSNEYSALSENMDFSQATIDEFIHSGVNLCYGI LQVVLSLLPSGIGAVLSVVGFHGSREDGLRLVWRATKQRNIHGCIGLLGLMFYYDGPFQF TDADFDIPVPENELKKTKSSSTYEEGDLDGPTLLHPGKILEDALLQSRALFPHSALWLLN EATMLSGQGRLRDSVKLMDSIEADKIEMRQVKSLLIFNRALTLVHLHEYERAADDFLSLL DISSWSHSLYHYFAGSCYLEIYRMHQLGVRKSDRPEHFKQRATDLIFGAPNLLTRKSFNA RPLPLDRFMLRKVDQFKATQKRLKLSDPLDAIATSPVHELQYFYNGYNRMGKQDLELANI MLTEYHNPAIDAKEPNQEMIKDFLVSLTYRRLDRAEEGCELLDRNVLPKIFTMVNGKVKY FKKTEDPWLYPSALYERSLFSWKLKHMDGLEESKEWLTRAQGYADDYELSTRVEMKIKAA IDRVDESL
Uniprot No.

Target Background

Function

IML2 is an inclusion body (IB) resident protein that exhibits strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access to the IBs of an LD-stored, soluble sterol derivative functioning as a chaperone in inclusion clearing.

Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is Vanderwaltozyma polyspora and why is it significant for mitochondrial protein research?

Vanderwaltozyma polyspora is a species of ascomycetous yeast in the family Saccharomycetaceae. It is characterized by the fermentation of glucose and galactose, the assimilation of nitrogen sources like ethylamine, nitrate, lysine, and cadaverine, and spores shaped spheroidal, oblong, or reniform . This organism has gained significance in mitochondrial protein research due to its unique genomic features and specialized protein expression patterns under various conditions. As demonstrated with other proteins like glycyl-tRNA synthetase (GlyRS), V. polyspora often possesses paralogous genes that respond differently to environmental stresses, making it an excellent model for studying mitochondrial protein adaptation and function .

How does IML2 differ from other mitochondrial membrane proteins in Vanderwaltozyma polyspora?

While specific data on IML2 is limited in the current literature, we can draw parallels from studies of other V. polyspora proteins. V. polyspora often expresses proteins with specialized functions that may differ from homologous proteins in related species. For instance, with glycyl-tRNA synthetase, V. polyspora possesses two paralogous genes (GRS1 and GRS2) that respond differently to stress conditions. GRS1 functions in both cytoplasm and mitochondria under normal conditions, while GRS2 is activated under stress conditions . Similarly, IML2 as a mitochondrial outer membrane protein likely plays specific roles in mitochondrial function that may be uniquely regulated in V. polyspora compared to other yeasts.

What expression systems are recommended for producing recombinant V. polyspora IML2?

Based on established practices for recombinant yeast proteins, the following expression systems are recommended for V. polyspora IML2:

Expression SystemAdvantagesLimitationsBest Use Case
E. coliHigh yield, rapid growth, economicalMay have improper folding for eukaryotic proteinsInitial structural studies
Yeast (S. cerevisiae)Proper post-translational modificationsLower yield than E. coliFunctional studies
Insect cellsGood for membrane proteinsMore complex, expensiveStructural biology
Animal-free systemsEliminates experimental variables from animal componentsMay require optimizationStudies requiring high purity

The selection of an appropriate expression system should be based on the specific research needs. For functional studies of IML2, yeast-based systems may provide the most physiologically relevant environment for proper protein folding and post-translational modifications.

What purification strategies yield the highest purity for recombinant V. polyspora IML2 protein?

Purification of mitochondrial membrane proteins like IML2 requires specialized approaches to maintain protein stability and functionality. Based on established protocols for similar proteins, a multi-step purification strategy is recommended:

  • Initial extraction using specialized detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) that maintain membrane protein integrity

  • Affinity chromatography utilizing engineered tags (His, FLAG, or Strep)

  • Size exclusion chromatography to remove aggregates and contaminants

  • Ion exchange chromatography for final polishing

For animal-free applications, all reagents should be sourced from non-animal origins to eliminate experimental variables caused by trace animal components or mammalian pathogens . Verification of purity should be performed using SDS-PAGE, with expected purity exceeding 85% as typically observed with recombinant V. polyspora proteins .

How can researchers assess proper folding and functionality of recombinant IML2?

Assessment of proper folding for IML2 should employ multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

  • Thermal shift assays to evaluate protein stability

  • Limited proteolysis to assess compact folding

  • Functional assays specific to outer membrane proteins, including:

    • Liposome incorporation assays

    • Membrane potential measurements

    • Interaction studies with known binding partners

    • Subcellular localization in model systems

Functionality can be further validated through complementation studies in knockout models, similar to methods used for other V. polyspora proteins where gene function was assessed by rescue experiments in related yeast species .

What techniques are most effective for studying IML2 interactions with other mitochondrial proteins?

Multiple approaches should be combined for comprehensive interaction studies:

TechniqueResolutionInformation GainedLimitations
Co-immunoprecipitationMediumIn vivo interactionsMay miss transient interactions
Proximity labeling (BioID/APEX)MediumSpatial proximity in vivoCannot distinguish direct vs. indirect
Crosslinking mass spectrometryHighDirect contact sitesComplex data analysis
Surface plasmon resonanceHighBinding kineticsRequires purified proteins
Microscale thermophoresisHighAffinity in solutionSample consumption
Cryo-EMVery highStructural complexesTechnical complexity

When investigating potential interactions, researchers should consider the common experimental challenge that mitochondrial membrane proteins often form complexes that are sensitive to extraction conditions. Optimization of detergent types and concentrations is critical to maintain physiologically relevant protein-protein interactions.

How can researchers interpret contradictory results in IML2 functional studies?

Contradictory results in IML2 studies may arise from several factors:

  • Different experimental conditions affecting protein behavior

  • Strain-specific variations in V. polyspora

  • Differences in recombinant protein preparation

  • Cellular stress responses affecting mitochondrial function

To resolve such contradictions, researchers should:

  • Standardize experimental conditions across studies

  • Compare results across multiple strains and expression systems

  • Validate findings using both in vitro and in vivo approaches

  • Consider the impact of environmental factors on protein function

Drawing a parallel from studies on V. polyspora GlyRS2, which showed different activity levels at varying temperatures (active at 30°C and 37°C but inactive above 40°C in vitro), researchers should be particularly attentive to temperature and other environmental variables that may dramatically affect protein function .

How does IML2 function compare between V. polyspora and other yeast species?

Comparative analysis of IML2 across yeast species provides valuable evolutionary insights. While specific comparative data for IML2 is not directly presented in the current literature, we can infer methodological approaches based on studies of other V. polyspora proteins:

  • Sequence alignment and phylogenetic analysis to identify conserved domains

  • Complementation studies to test functional conservation

  • Subcellular localization comparisons

  • Stress response profiling across species

V. polyspora often shows unique adaptations in protein function, as evidenced by its two distinct GlyRS genes that respond differently to environmental stresses . Researchers should investigate whether IML2 shows similar specialized functions compared to homologs in related species like Saccharomyces cerevisiae.

What are the implications of IML2 research for understanding mitochondrial evolution?

Research on IML2 and other V. polyspora mitochondrial proteins contributes to our understanding of:

  • The evolution of mitochondrial membrane organization

  • Adaptation of organellar proteins to environmental stresses

  • Co-evolution of nuclear and mitochondrial genomes

  • Specialized functions that emerged in different yeast lineages

The presence of condition-specific expression patterns, as observed with other V. polyspora proteins like GRS2 (activated under stress conditions) , suggests that researchers should examine whether IML2 shows similar adaptive patterns that reflect evolutionary specialization.

How can advanced computational approaches enhance IML2 structural and functional predictions?

Modern computational approaches provide powerful tools for IML2 research:

  • AlphaFold2 and RoseTTAFold for structure prediction

  • Molecular dynamics simulations to study membrane integration

  • Coevolution analysis to identify functional networks

  • Machine learning approaches to predict condition-specific regulation

These computational methods are particularly valuable when integrated with experimental data. For instance, structural predictions can guide site-directed mutagenesis experiments to test functional hypotheses, similar to approaches that might be used to study the differential temperature sensitivity observed in other V. polyspora proteins .

What considerations are important when designing CRISPR-Cas9 experiments targeting IML2 in V. polyspora?

When designing gene editing experiments for IML2, researchers should consider:

  • Guide RNA design specific to V. polyspora genomic context

  • Potential for off-target effects based on genome sequence analysis

  • Homology-directed repair templates for precise modifications

  • Phenotypic assays to detect mitochondrial function changes

  • Controls for distinguishing cytoplasmic vs. mitochondrial effects

Additionally, researchers should consider the possibility that, like GRS1 in V. polyspora, IML2 might have paralogous genes or dual subcellular localization that could complicate interpretation of knockout experiments .

How should researchers design experiments to study IML2 behavior under stress conditions?

Based on observations of other V. polyspora proteins like GRS2, which is activated under stress conditions , researchers should design comprehensive stress-response experiments:

Stress ConditionMeasurement ParametersTechnical Considerations
Temperature stress (30-42°C)Protein expression, localization, activityControl for general heat shock response
Oxidative stress (H₂O₂, paraquat)ROS levels, mitochondrial morphologyDose-dependent effects
pH stress (pH 5-9)Membrane integrity, protein stabilityBuffer compatibility
Nutrient limitationExpression levels, metabolic impactGrowth phase standardization
Ethanol stressMembrane fluidity, protein functionAdaptation vs. acute effects

Careful experimental design should include time-course analyses to distinguish between immediate responses and adaptive changes, as well as controls to differentiate IML2-specific effects from general stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.