Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 2-B (MCR1B)

What is Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 2-B (MCR1B) and what is its primary function?

NADH-cytochrome b5 reductase 2-B (MCR1B) is a mitochondrial flavoprotein from the yeast Vanderwaltozyma polyspora that catalyzes the transfer of electrons from NADH to cytochrome b5. The enzyme contains an FAD cofactor and plays a critical role in electron transport systems. Vanderwaltozyma polyspora (formerly known as Kluyveromyces polysporus) is a multi-spored yeast fungus in the family Saccharomycetaceae that has been isolated from soil environments .

The primary sequence of MCR1B contains 306 amino acids as described in product specifications, and the enzyme functions with EC classification 1.6.2.2 (NADH:cytochrome b5 reductase) . The functional enzyme transfers electrons from NADH to cytochrome b5, supporting various metabolic processes including lipid metabolism and possible involvement in sterol biosynthesis.

What are the optimal storage and handling conditions for recombinant MCR1B?

Based on product information for recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 2-B:

The protein has demonstrated >85% purity when analyzed by SDS-PAGE . For experimental work, brief centrifugation of the vial prior to opening is recommended to bring contents to the bottom of the tube.

How does V. polyspora MCR1B compare with cytochrome b5 reductases from other organisms?

Cytochrome b5 reductases across different species share similar catalytic mechanisms but may differ in structural features and catalytic efficiency. For example:

• The Physarum polycephalum NADH-cytochrome b5 reductase consists of 281 amino acid residues, which is 25 residues shorter than vertebrate enzymes, yet demonstrates comparable enzymatic activity to human enzymes .

• V. polyspora MCR1B (306 amino acids) shows sequence homology with other fungal cytochrome b5 reductases, including those from Saccharomyces cerevisiae.

• Fungal cytochrome b5 reductases, including V. polyspora MCR1B, can support the electron transfer in cytochrome P450 reactions. In some fungi, the cytochrome b5/NADH cytochrome b5 reductase system can wholly and efficiently support CYP51-mediated sterol 14α-demethylation .

• Compared to bacterial MCR systems (which are unrelated but share a similar acronym), V. polyspora MCR1B has entirely different structure and function. The bacterial MCR-1 is a phosphoethanolamine transferase that modifies lipid A to confer antibiotic resistance , whereas MCR1B is involved in electron transport processes.

What expression systems are commonly used for producing recombinant MCR1B?

For recombinant production of V. polyspora MCR1B and similar cytochrome b5 reductases, several expression systems have been documented:

For optimal expression using yeast systems like Pichia pastoris, parameters to consider include:

• Growth conditions: YPD (1% yeast extract, 2% peptone, 2% dextrose) for biomass generation

• Alternative carbon sources: YPGL (2% glycerol, 2% lactic acid, pH 6.0) or YPGE (2% glycerol, 2% ethanol)

• Selective media: SDC-uracil or SGLC-uracil for maintaining plasmids in transformed yeast

What role does MCR1B play in the electron transport system of V. polyspora mitochondria?

MCR1B (Mitochondrial Cytochrome b Reductase B) functions as an integral component of the yeast mitochondrial electron transport system. Based on research with related cytochrome b5 reductases:

• Dual electron transport pathways: MCR1B likely participates in an alternative electron transport pathway similar to what has been observed in other yeast species. While the conventional pathway involves electron transfer from NADPH cytochrome P450 reductase (CPR) to cytochrome P450, MCR1B can participate in an alternative pathway where both first and second electrons are donated via the NADH cytochrome b5 electron transport system .

• Respiratory chain contribution: In yeast strains with defects in the conventional pathway, the MCR1B-supported electron transport can maintain essential functions like sterol biosynthesis, explaining the continued ergosterol production seen in yeast strains containing disruptions of genes encoding CPR .

• Mitochondrial respiratory complex activities: Assessment of mitochondrial electron transport chain complex activities in yeast involves measuring:

  • Antimycin A-sensitive NADH-coupled cytochrome c reductase (NCCR) activity

  • Ubiquinol-coupled cytochrome c reductase (QCCR)

  • Succinate dehydrogenase (SDH)

  • Cytochrome c oxidase (COX) activities

This can be measured using protocols where mitochondrial fractions (typically 2.5 μg) are solubilized in complex activity buffer containing 25 mM KPi buffer (pH 7.2), 5 mM MgCl2, 2 mM KCN, 2.5 mg/ml bovine serum albumin, and 0.5 mM n-dodecyl-β-maltoside, supplemented with 1.4 mM NADH. The rate of cytochrome c (50 μM) reduction can be measured spectrophotometrically (ΔAbs 550) before and after the addition of specific inhibitors .

How can researchers effectively measure the enzymatic activity of purified recombinant MCR1B?

Measurement of MCR1B enzymatic activity requires specialized protocols focusing on electron transfer capabilities:

Standard Enzyme Activity Assay Protocol:

• Preparation of enzyme sample:

  • Prepare crude mitochondrial fractions from yeast grown to midlog phase in appropriate media (e.g., YPGL)

  • Disrupt cells and obtain mitochondrial fractions via differential centrifugation

  • Resuspend mitochondrial pellets in 20 mM KPi buffer, pH 7.4

  • Subject to three freeze-thaw cycles at -80°C

  • Determine protein concentration using Bradford protein assay and dilute to 250 μg/ml in KPi buffer

• NADH-cytochrome c reductase activity assay:

  • Reaction mixture: complex activity buffer (25 mM KPi buffer, pH 7.2, 5 mM MgCl2, 2 mM KCN, 2.5 mg/ml BSA, 0.5 mM n-dodecyl-β-maltoside) with 1.4 mM NADH

  • Measure the rate of cytochrome c (50 μM) reduction at 550 nm

  • Determine antimycin A-sensitive activity by measuring before and after addition of 2 μg/ml antimycin A

• Determination of kinetic parameters:

  • For MCR1B, expected parameters based on similar enzymes include:

    • pH optimum around 6.0

    • Km values of approximately 2-14 μM for NADH and cytochrome b5, respectively

    • Characteristic FAD-derived absorption peaks at around 460 nm with a shoulder at 480 nm

What structural features contribute to MCR1B substrate specificity and catalytic activity?

The structural features of MCR1B that contribute to its function include:

• Domain organization:

  • N-terminal membrane-binding domain (based on sequence similarity to other cytochrome b5 reductases)

  • FAD-binding domain containing conserved motifs for flavin binding

  • NADH-binding domain with specific residues for cofactor interaction

  • Catalytic domain containing conserved residues essential for electron transfer

• Key conserved residues:
  While specific residues for V. polyspora MCR1B haven't been individually characterized in the search results, similar enzymes typically contain:

  • Conserved FAD-binding motifs including glycine-rich sequences

  • NADH-binding residues that form hydrogen bonds with the nicotinamide portion

  • Catalytic residues facilitating electron transfer between NADH and FAD, and subsequently to cytochrome b5

• Spectroscopic properties:

  • Characteristic FAD-derived absorption spectrum with peaks at approximately 460 nm and a shoulder at 480 nm

  • These spectral features can be used to assess correct folding and cofactor incorporation in recombinant enzyme preparations

How does MCR1B function in sterol biosynthesis pathways in V. polyspora?

MCR1B likely plays a significant role in sterol biosynthesis based on research with similar fungal cytochrome b5 reductases:

• Alternative electron donor in sterol 14α-demethylation:

  • In fungi, the cytochrome b5/NADH cytochrome b5 reductase system can wholly and efficiently support CYP51-mediated sterol 14α-demethylation

  • This alternative catalytic cycle allows continued ergosterol production even when the conventional NADPH cytochrome P450 reductase (CPR) pathway is disrupted

• Metabolic adaptation to environmental conditions:

  • V. polyspora, like other yeasts that underwent whole genome duplication, adapted metabolic pathways to increase glucose metabolism in high-glucose environments

  • These adaptations include modifications in electron transport systems supporting sterol biosynthesis

• Metabolic regulation in response to stress:

  • Yeast strains can be tested for oxidative stress responses by measuring growth in the presence of menadione sodium bisulfite

  • Growth assays in non-fermentable media like YPGE with or without supplementation of stressors can reveal the importance of electron transport systems in stress adaptation

What are the considerations for designing site-directed mutagenesis experiments to study MCR1B functional domains?

When designing site-directed mutagenesis experiments to investigate MCR1B functional domains, researchers should consider:

• Target residue selection:

  • Conserved FAD-binding residues that may affect cofactor incorporation

  • NADH-binding pocket residues that could alter substrate affinity

  • Catalytic residues potentially involved in electron transfer

  • Membrane-binding domain residues that affect subcellular localization

• Mutation strategy:

  • Conservative mutations that maintain similar physicochemical properties to assess subtle functional effects

  • Non-conservative mutations to completely disrupt specific interactions

  • Domain truncations similar to the approach used in studying UPS proteins (e.g., ups2-Δ181, ups2-Δ210)

• Functional assay design:

  • Enzymatic activity measurements comparing wild-type and mutant proteins

  • Spectroscopic analysis to assess cofactor binding (FAD absorption spectrum)

  • Yeast complementation assays to test in vivo function

  • Growth assays under various stress conditions to detect physiological effects

• Primer design considerations:

  • Specific primers with appropriate annealing temperatures (e.g., UPS2 amplicon: annealing temperature 50°C; 28 amplification cycles)

  • Control gene amplification (e.g., ACT1 amplicon: annealing temperature 55°C; 25 amplification cycles)

How does MCR1B activity relate to mitochondrial phospholipid composition?

Research on mitochondrial proteins suggests a relationship between electron transport systems and phospholipid composition:

• Extraction and analysis methods:

  • Phospholipids can be extracted from crude mitochondrial fractions of exponentially growing yeast

  • Quantification determined by complexation with ammonium ferrothiocyanate in chloroform

  • Analysis using high-performance thin layer chromatography plates (1.8% boric acid in 100% ethanol)

  • Development with chloroform/ethanol/water/triethylamine (30:35:7:35, v/v/v/v)

  • Visualization by charring plates at 160°C after treatment with 470 mM CuSO4 in 8.5% o-phosphoric acid

• Key phospholipids affecting membrane-bound enzymes:

  • Cardiolipin (CL) and phosphatidylethanolamine (PE) are particularly important for mitochondrial enzyme function

  • Changes in these phospholipids can affect the activity of membrane-bound enzymes like MCR1B

• Relationship to electron transport efficiency:

  • Alterations in phospholipid composition can affect the efficiency of electron transport

  • This may impact MCR1B function through changes in membrane fluidity or direct interactions with the enzyme

What are the key differences between MCR1A and MCR1B isoforms in V. polyspora?

Vanderwaltozyma polyspora possesses two isoforms of mitochondrial cytochrome b reductase - MCR1A and MCR1B - which have distinct characteristics:

• Sequence comparison:

  • MCR1A (partial) is an identified product available commercially

  • MCR1B consists of 306 amino acids with the sequence starting with "MISSFTSLGSRPLLLSSGIAVTAAAAVYFSTGSRLANEALHNKTFKGFKGPASTWVDLPL..."

  • Both are annotated as NADH-cytochrome b5 reductase with EC number 1.6.2.2

• Structural features:

  • Both contain regions for membrane binding, FAD binding, and NADH binding

  • Sequence differences likely impact substrate specificity or regulatory properties

• Functional implications:

  • The presence of two isoforms suggests potential differential regulation or localization

  • This may be related to the metabolic adaptations following whole genome duplication in the yeast lineage

How can differential gene expression analysis be used to understand MCR1B regulation in V. polyspora?

Investigating MCR1B regulation through differential gene expression analysis requires:

• RNA extraction and RT-PCR methodology:

  • Total RNA isolation using TRIzol reagent followed by DNase I treatment

  • Reverse transcription using SuperScript III first-strand synthesis

  • Semi-quantitative PCR comparing MCR1B expression with control genes like ACT1

  • Typical PCR conditions: annealing temperature 50-55°C, 25-28 amplification cycles

• Growth conditions for expression comparison:

  • Fermentative conditions: YPD (1% yeast extract, 2% peptone, 2% dextrose)

  • Non-fermentative conditions: YPGL (2% glycerol, 2% lactic acid) or YPGE (2% glycerol, 2% ethanol)

  • Stress conditions: supplementation with oxidative stressors like menadione

• High-throughput approaches:

  • RNA-Seq for genome-wide expression profiling

  • Analysis of co-expressed genes to identify regulatory networks

  • Comparison with other yeasts to identify conserved regulation patterns

• Promoter analysis:

  • Identification of regulatory elements in the MCR1B promoter

  • Potential for transcriptional engineering approaches similar to those used for GAP promoter in other yeasts