Recombinant Vanderwaltozyma polyspora Nuclear rim protein 1 (NUR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NUR1; Kpol_1032p72; Nuclear rim protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
NUR1
Target Protein Sequence
MNGLDDENQIDERDHYTDDGDYEIDIDSMNMFKSLYYEMMAYFSDLQMHLGEHLMAIDWD MKCKSIAEPVGNCLTALFYIIRLLQDTLLSNYKDVYVSTEAFDLSKSTTLQEFPFLIRFV EVSKTKNLQNAKYIKKKTFMFYFDKLLLFLMILILSTNAYISWTFIWRNFKTYSLLYVVD RPNSKNVTKCSRTDLDQSYMENVSYGSYWTMLSYYIRNFRKKDDLEDEITTVKQKTPNVN EKDYYYQLKKWSPSKFLTSLFCSFSPTCLVFLILSDVSFTTSIAVILHQFIFKYVVFEGY ESRINDESIIHSAMISEINQKFVEPRLSKKVQDAKIDATPEGKVYRTEFFPSLTNCKSNL FNRHDLKGRSITESYNDRIKEFEIVTNTNNETHNVIKVVKK
Uniprot No.

Target Background

Function
A component of the perinuclear network regulating recombination at multiple loci to maintain genome stability. Essential for rDNA repeat stability.
Database Links
Protein Families
NUR1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora Nuclear rim protein 1 (NUR1)?

Nuclear rim protein 1 (NUR1) in Vanderwaltozyma polyspora is a member of the NUR1 protein family that likely functions to maintain genome stability. V. polyspora is a multi-spored yeast fungus in the family Saccharomycetaceae, first described by Johannes P. van der Walt and later reclassified by Cletus P. Kurtzman in 2003 . By comparison with homologous proteins in other yeasts such as Zygosaccharomyces rouxii, NUR1 appears to be part of a perinuclear network that controls recombination at multiple loci and is required for rDNA repeat stability .

How is V. polyspora taxonomically classified?

Vanderwaltozyma polyspora belongs to the following taxonomic classification:

  • Domain: Eukaryota

  • Kingdom: Fungi

  • Division: Ascomycota

  • Class: Saccharomycetes

  • Order: Saccharomycetales

  • Family: Saccharomycetaceae

  • Genus: Vanderwaltozyma

  • Species: V. polyspora (van der Walt) Kurtzman 2003

What are the general characteristics of V. polyspora as an organism?

V. polyspora is characterized by:

  • Fermentation of glucose and galactose

  • Assimilation of nitrogen sources including ethylamine, nitrate, lysine, and cadaverine

  • Production of oblong to reniform ascospores that release quickly

  • Ability to produce up to 100 ascospores due to supernumerary mitosis in the ascus parent cell

  • Growth on agar with cream to brownish color and butyrous to glossy appearance

  • Rare isolation from natural sources (only eight strains reported until 2020)

What is the predicted molecular weight and sequence characteristics of V. polyspora NUR1?

Based on homology with the NUR1 protein from Zygosaccharomyces rouxii, V. polyspora NUR1 is likely approximately 55-60 kDa in size. The Z. rouxii NUR1 is 511 amino acids in length with a molecular weight of 58.9 kDa . Sequence analysis would typically reveal conserved domains characteristic of nuclear rim proteins involved in genome stability.

What expression systems are recommended for recombinant production of V. polyspora NUR1?

Several expression systems can be considered for recombinant production:

Expression SystemAdvantagesLimitationsBest For
E. coli (BL21, Rosetta)High yield, rapid growth, cost-effectiveMay lack proper eukaryotic modificationsInitial structural studies, antibody production
Yeast (P. pastoris, S. cerevisiae)Native-like post-translational modificationsLower yield than bacterial systemsFunctional studies requiring authentic processing
Insect cells (Sf9, Hi5)Complex eukaryotic protein folding capabilityHigher cost, longer production timeStudies requiring proper folding of complex domains
Mammalian cells (HEK293, CHO)Most authentic post-translational modificationsHighest cost, lowest yieldInteraction studies with mammalian partners

What are the optimal purification strategies for recombinant V. polyspora NUR1?

A multi-step purification strategy is recommended:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged protein

    • Glutathione affinity chromatography for GST-fusion proteins

    • Strep-Tactin affinity chromatography for Strep-tagged proteins

  • Intermediate purification:

    • Ion exchange chromatography based on theoretical pI

    • Heparin affinity chromatography (especially useful for DNA-binding proteins)

  • Polishing:

    • Size exclusion chromatography to remove aggregates and verify oligomeric state

    • Hydroxyapatite chromatography for final purity

What assays can be used to verify the functionality of recombinant V. polyspora NUR1?

Multiple complementary assays can assess NUR1 functionality:

Assay TypeMethodologyData GeneratedTechnical Considerations
DNA bindingElectrophoretic Mobility Shift Assay (EMSA)Qualitative binding to DNA substratesRequires optimization of salt and pH conditions
DNA bindingFluorescence AnisotropyQuantitative binding constants (Kd)Requires fluorescently labeled DNA substrates
Protein interactionPull-down assaysIdentification of binding partnersMay miss transient or weak interactions
Protein interactionSurface Plasmon ResonanceAssociation/dissociation kineticsRequires highly pure protein samples
ComplementationYeast genetic complementationIn vivo functional rescueRequires NUR1-deficient yeast strain
LocalizationImmunofluorescence microscopySubcellular localization patternRequires specific antibodies or fluorescent tags

How can the role of V. polyspora NUR1 in genome stability be experimentally assessed?

Assessment strategies include:

  • rDNA stability assays:

    • Southern blot analysis of rDNA repeat numbers

    • Pulsed-field gel electrophoresis to detect rDNA rearrangements

    • Quantitative PCR to measure extrachromosomal rDNA circle formation

  • Recombination rate measurements:

    • Fluctuation analysis using reporter constructs

    • Direct measurement of recombination between chromosomal markers

    • Sister chromatid exchange frequency determination

  • DNA damage response assays:

    • Survival curves following exposure to genotoxic agents

    • Comet assay to detect DNA breaks

    • γH2AX foci formation as a marker of DNA damage response

How can protein-protein interaction studies be designed to identify NUR1 binding partners?

Multiple complementary approaches can be employed:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged NUR1 in V. polyspora

    • Perform pull-down under various conditions (normal growth, DNA damage)

    • Identify binding partners using LC-MS/MS

    • Validate interactions with co-immunoprecipitation

  • Proximity-based labeling methods:

    • Generate BioID or TurboID fusion with NUR1

    • Express in V. polyspora and allow proximity-dependent biotinylation

    • Purify biotinylated proteins and identify by mass spectrometry

    • Use statistical analysis to distinguish specific from non-specific interactions

  • Yeast two-hybrid screening:

    • Use NUR1 as bait to screen genomic or cDNA libraries

    • Validate positive interactions with orthogonal methods

    • Map interaction domains through deletion analysis

What structural biology approaches are suitable for studying V. polyspora NUR1?

Structural characterization can employ several techniques:

How can CRISPR-Cas9 genome editing be applied to study NUR1 function in V. polyspora?

CRISPR-Cas9 applications include:

  • Gene knockout studies:

    • Design sgRNAs targeting NUR1 coding sequence

    • Introduce DSBs followed by non-homologous end joining (NHEJ) repair

    • Screen for loss-of-function mutants

    • Assess phenotypic consequences on genome stability

  • Domain function analysis:

    • Use homology-directed repair (HDR) to introduce specific mutations

    • Create truncations targeting predicted functional domains

    • Generate tagged versions for localization and interaction studies

    • Produce conditional alleles using auxin-inducible degron technology

  • Genetic interaction mapping:

    • Combine NUR1 mutations with mutations in potential pathway components

    • Perform synthetic genetic array analysis with NUR1 knockout

    • Use CRISPRi for combinatorial repression of multiple genes

What are the current contradictions or knowledge gaps regarding NUR1 function across yeast species?

Several contradictions exist in the current understanding:

  • Species-specific variations:

    • Differences in phenotypic severity of NUR1 deletions across yeast species

    • Variations in genetic interaction networks

    • Divergent subcellular localization patterns reported

    • Inconsistent DNA damage sensitivity profiles

  • Mechanistic uncertainties:

    • Direct versus indirect effects on rDNA stability

    • Relationship between nuclear membrane association and function

    • Temporal regulation during cell cycle progression

    • Coordination with other genome maintenance pathways

  • Technical limitations:

    • Limited structural data available for any NUR1 family member

    • Challenges in biochemical reconstitution of functional complexes

    • Variable antibody specificity across species

What are the technical challenges in working with recombinant V. polyspora NUR1?

Researchers face several technical challenges:

  • Expression and solubility issues:

    • Tendency toward aggregation or insolubility

    • Inconsistent yield between expression batches

    • Potential toxicity to host expression systems

    • Sensitivity to proteolysis during purification

  • Functional assessment limitations:

    • Lack of established in vitro activity assays

    • Difficulty in reconstituting complex nuclear environment

    • Challenges in distinguishing direct from indirect effects

    • Limited availability of V. polyspora-specific research tools

  • Structural analysis obstacles:

    • Potential conformational heterogeneity

    • Presence of disordered regions complicating crystallization

    • Size limitations for solution NMR studies

    • Need for stabilizing interaction partners

How can advanced imaging techniques be applied to study NUR1 localization and dynamics?

Advanced imaging approaches include:

  • Super-resolution microscopy:

    • Stimulated Emission Depletion (STED) microscopy for 30-70 nm resolution

    • Photoactivated Localization Microscopy (PALM) for protein dynamics

    • Structured Illumination Microscopy (SIM) for 3D imaging of nuclear distribution

  • Live-cell imaging strategies:

    • Endogenous tagging with mNeonGreen or other bright fluorophores

    • Fluorescence Recovery After Photobleaching (FRAP) to measure mobility

    • Single-particle tracking to follow individual molecules

    • Lattice light-sheet microscopy for extended imaging with minimal phototoxicity

  • Multi-modal approaches:

    • Correlative Light and Electron Microscopy (CLEM) for ultrastructural context

    • Split-fluorescent protein complementation for interaction mapping

    • Optogenetic control of NUR1 localization or activity

What emerging technologies hold promise for advancing V. polyspora NUR1 research?

Cutting-edge approaches include:

  • Integrative structural biology:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Integrative modeling combining low and high-resolution data

    • Time-resolved structural methods to capture conformational changes

  • Advanced genomic technologies:

    • Hi-C and related methods to map 3D genome organization

    • Nanopore sequencing for long-read structural variant detection

    • Cut&Run or CUT&Tag for precise chromatin binding site mapping

  • Single-cell approaches:

    • Single-cell RNA-seq to map expression in heterogeneous populations

    • Single-cell proteomics for protein abundance variation

    • Microfluidic approaches for high-throughput phenotyping

How might comparative studies across species advance understanding of NUR1 function?

Cross-species approaches offer several advantages:

  • Evolutionary functional analysis:

    • Systematic complementation studies across yeast species

    • Identification of conserved versus lineage-specific functions

    • Correlation of sequence conservation with functional importance

    • Reconstruction of ancestral NUR1 sequences to test evolutionary hypotheses

  • Comparative genomics integration:

    • Analysis of synteny and gene neighborhood conservation

    • Correlation with species-specific genomic features

    • Identification of coevolving protein families

    • Detection of positive selection signatures in specific domains

  • Experimental evolution approaches:

    • Laboratory evolution experiments under genome instability conditions

    • Tracking compensatory mutations in NUR1-deficient backgrounds

    • Cross-species hybrid studies to map species-specific functions

What therapeutic or biotechnological applications might emerge from V. polyspora NUR1 research?

Potential applications include:

  • Basic research tools:

    • Development of NUR1-based biosensors for genome instability

    • Creation of model systems for studying recombination mechanisms

    • Exploitation of unique ascospore production capabilities

  • Biotechnological applications:

    • Engineering strains with enhanced genome stability for industrial applications

    • Development of yeast strains with controlled DNA recombination rates

    • Exploitation of V. polyspora's unique property to produce up to 100 ascospores

  • Biomedical relevance:

    • Insights into fundamental mechanisms of genome maintenance

    • Understanding recombination control with implications for cancer biology

    • Identification of conserved pathways potentially targetable in human disease

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.