Recombinant Vanderwaltozyma polyspora Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol, which serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize developing your specified tag.
Synonyms
LCL3; Kpol_1002p63; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
LCL3
Target Protein Sequence
MSDIDEKNDTKESSFSSDVVLLSLLISGSTLGAIAGYNRYLKQVTKATDIPNYMFRKRWM YGKVTAVGDGDNFHLFHTPGGIFGGWGWLRKVPKLPKSDSNGLIVSRKKTSNFYSGLKNS YHKFTGSYRYSSEYFLDLKVPYKNLRNLPTVPIRLCAIDAPERAHFGNTSQPYGDEALIW LRNRLLGKYVWVKPLSVDQYNRCVSKVVCWNWLGWQNISLQMVRQGLAVVYEGKTSAEFD REEFLYRFYERRSKAKKRGLWRQRVIETPGEYKKKIKK
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora and how is it taxonomically classified?

Vanderwaltozyma polyspora is an ascomycetous yeast belonging to the family Saccharomycetaceae. The genus Vanderwaltozyma was established by Cletus P. Kurtzman in 2003, named in honor of the South African mycologist Johannes P. van der Walt (1925-2011), who first described this organism (originally in the Kluyveromyces genus). Taxonomically, it is classified as follows: Kingdom Fungi, Division Ascomycota, Class Saccharomycetes, Order Saccharomycetales, Family Saccharomycetaceae, Genus Vanderwaltozyma. The type strain of V. polyspora is ATCC 22028 / DSM 70294, formerly known as Kluyveromyces polysporus .

Vanderwaltozyma species are characterized by their ability to ferment glucose and galactose, and their capacity to assimilate various nitrogen sources including ethylamine, nitrate, lysine, and cadaverine. Morphologically, they produce spores that can be spheroidal, oblong, or reniform (kidney-shaped) .

What is the LCL3 gene product and what is its predicted function?

The LCL3 gene (also annotated as Kpol_1002p63) from Vanderwaltozyma polyspora encodes a protein predicted to function as an endonuclease. Endonucleases are enzymes that cleave phosphodiester bonds within polynucleotide chains, and they play crucial roles in DNA replication, repair, recombination, and restriction-modification systems. The classification of LCL3 as a "probable endonuclease" suggests that its function has been predicted through sequence homology or structural analysis, but may not have been fully characterized experimentally .

Based on knowledge of similar endonucleases, LCL3 likely recognizes specific DNA sequences and cleaves the phosphodiester backbone at defined positions. While the exact recognition sequence for LCL3 has not been explicitly stated in the available sources, other characterized endonucleases like those in the Type III restriction enzyme family recognize specific DNA sequences and cleave DNA based on the relative arrangement of these recognition sites .

What expression systems are available for producing recombinant LCL3?

Recombinant Vanderwaltozyma polyspora probable endonuclease LCL3 can be produced using multiple expression systems, each offering distinct advantages for research applications:

Expression SystemProduct Code ExampleFeatures and Considerations
YeastCSB-YP419261VDW1Native-like post-translational modifications, proper protein folding, suitable for complex proteins
E. coliCSB-EP419261VDW1High yield, cost-effective, rapid expression, but may lack eukaryotic post-translational modifications
E. coli with in vivo biotinylationCSB-EP419261VDW1-BContains Avi-tag biotinylated in vivo by AviTag-BirA technology, useful for detection and immobilization applications
BaculovirusCSB-BP419261VDW1Insect cell expression, suitable for complex eukaryotic proteins requiring proper folding
Mammalian cellCSB-MP419261VDW1Most authentic post-translational modifications, ideal for functional studies requiring mammalian-specific processing

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications, protein solubility, and intended applications .

What structural and functional domains characterize LCL3 endonuclease?

While the specific domain architecture of LCL3 is not detailed in the provided sources, endonucleases typically contain well-defined functional domains that contribute to their catalytic activity and substrate recognition. By analogy with other characterized endonucleases, LCL3 likely contains:

  • DNA-binding domain: Responsible for recognizing specific DNA sequences

  • Catalytic domain: Contains the active site responsible for phosphodiester bond hydrolysis

  • Regulatory domain: May modulate enzyme activity in response to cofactors or cellular conditions

Some endonucleases, particularly those involved in restriction-modification systems, feature domains similar to those observed in the GajA protein, which has an N-terminal ATPase-like domain and a C-terminal TOPRIM (topoisomerase-primase) domain . The TOPRIM domain is typically associated with magnesium-dependent enzymatic activity involved in DNA strand breakage and rejoining.

Researchers investigating the structure-function relationship of LCL3 should consider employing techniques such as limited proteolysis coupled with mass spectrometry, X-ray crystallography, or cryo-electron microscopy to elucidate its domain organization and three-dimensional structure.

How might nucleotide binding regulate LCL3 activity?

Based on insights from other endonucleases, nucleotide binding could play a significant role in regulating LCL3 activity. For instance, the GajA endonuclease exhibits a notable sensitivity to nucleotides, with its activity being strongly inhibited by all NTPs and dNTPs, including ATP, ADP, and their non-hydrolyzable analogs. This inhibition suggests a sophisticated regulatory mechanism that may respond to cellular energy status or nucleotide pool availability .

If LCL3 shares similar regulatory features, researchers should consider:

  • Testing LCL3 activity in the presence of various nucleotides at different concentrations

  • Examining potential allosteric effects by pre-incubating the enzyme with nucleotides before substrate addition

  • Investigating whether specific mutations in putative nucleotide-binding regions affect enzymatic activity

Understanding such regulatory mechanisms is crucial for optimizing in vitro reaction conditions and interpreting experimental results in cellular contexts where nucleotide concentrations fluctuate.

What would be the predicted recognition sequence and cleavage pattern of LCL3?

While the specific recognition sequence of LCL3 is not detailed in the available sources, insights from other characterized endonucleases provide valuable context for investigation. Type III restriction enzymes, for example, recognize specific sequences and typically require pairs of sites in head-to-head orientation for efficient DNA cleavage .

By analogy with the characterized GajA endonuclease, LCL3 might recognize a sequence with the following properties:

  • Partial palindromic structure

  • GC-rich core region that is critical for recognition

  • Flanking AT-rich regions that contribute to binding specificity

  • Central nucleotide that may tolerate substitutions

The cleavage pattern might involve double-strand breaks at defined distances from the recognition site, as observed with Type III restriction enzymes, or site-specific nicking as seen with some other endonucleases .

Researchers should employ systematic approaches to identify the LCL3 recognition sequence:

  • In vitro cleavage assays using DNA substrates with known sequences

  • High-throughput sequencing of cleavage products to identify consensus cut sites

  • Competition assays with synthetic oligonucleotides to determine binding preferences

What are the optimal conditions for reconstituting and storing recombinant LCL3?

Recombinant LCL3 is typically supplied as a lyophilized powder, requiring proper reconstitution to maintain activity. Based on standard practices for similar proteins:

  • Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Prior to opening, the vial should be briefly centrifuged to ensure all material is at the bottom.

  • For long-term storage, the reconstituted protein should be aliquoted to minimize freeze-thaw cycles and stored at -80°C.

  • Working solutions can be kept at 4°C for short periods (typically 1-2 weeks), though stability should be verified experimentally.

The optimal buffer conditions for enzymatic activity would likely include:

ComponentTypical RangePurpose
Tris-HCl or HEPES20-50 mM, pH 7.0-8.5Buffering capacity
NaCl or KCl50-200 mMIonic strength
MgCl₂5-10 mMCofactor for catalytic activity
DTT or β-mercaptoethanol1-5 mMReducing agent to maintain thiol groups
BSA0.1-1.0 mg/mLStabilizer, prevents adhesion to surfaces
Glycerol10-20%Stabilizer for storage

Researchers should systematically test these conditions to determine the optimal environment for LCL3 activity and stability .

How can the enzymatic activity of LCL3 be assayed?

Establishing reliable assays for LCL3 enzymatic activity is essential for characterization studies and quality control. Several complementary approaches could be employed:

1. Gel-based DNA cleavage assays:

  • Incubate LCL3 with supercoiled plasmid DNA containing potential recognition sites

  • Analyze reaction products by agarose gel electrophoresis to detect conversion to nicked or linear forms

  • Include controls: no-enzyme, heat-inactivated enzyme, and known restriction enzymes

2. Fluorescence-based assays:

  • Use fluorescently labeled oligonucleotides containing potential recognition sequences

  • Monitor cleavage by fluorescence resonance energy transfer (FRET) or fluorescence polarization changes

  • Enables real-time kinetic measurements and high-throughput screening of conditions

3. Radiolabeled substrate assays:

  • Employ ³²P-labeled DNA substrates for high sensitivity detection

  • Analyze cleavage products by denaturing polyacrylamide gel electrophoresis

  • Particularly useful for precise mapping of cleavage sites

Based on studies of similar endonucleases, researchers should consider testing LCL3 activity under various conditions:

ParameterVariables to TestRationale
Temperature25°C, 30°C, 37°C, 42°CDetermine temperature optimum
pH6.0-9.0 in 0.5 unit incrementsIdentify pH optimum
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺ at 1-10 mMDetermine cofactor requirements
Salt concentration0-300 mM NaCl or KClEstablish ionic strength dependence
NucleotidesATP, GTP, CTP, UTP at 0.1-5 mMTest for regulatory effects

How can in vivo biotinylation enhance LCL3 experimental applications?

The availability of in vivo biotinylated LCL3 (CSB-EP419261VDW1-B) provides significant advantages for various experimental applications. This form of the protein is produced using AviTag-BirA technology, where E. coli biotin ligase (BirA) catalyzes the covalent attachment of biotin to a specific lysine residue within the 15-amino acid AviTag peptide .

The biotinylated LCL3 can be utilized for:

1. Protein purification and enrichment:

  • Streptavidin affinity chromatography for one-step purification

  • Pull-down assays to identify protein-protein interactions

  • Enrichment from complex biological samples

2. Immobilization for functional studies:

  • Attachment to streptavidin-coated surfaces for single-molecule studies

  • Creation of enzyme-functionalized biosensors

  • Development of solid-phase enzymatic reactors

3. Detection and visualization:

  • Streptavidin-conjugated fluorophores for microscopy

  • Enzyme-linked assays using streptavidin-HRP conjugates

  • Surface plasmon resonance (SPR) for binding kinetics

The site-specific nature of the biotinylation (unlike chemical biotinylation) ensures that the tag does not interfere with the active site or crucial protein-protein interaction surfaces, making this approach particularly valuable for functional studies of enzymes like LCL3.

How does LCL3 compare to other characterized endonucleases?

While specific information about LCL3's mechanism is limited in the provided sources, comparing it to well-characterized endonucleases provides a framework for understanding its potential function and applications:

Endonuclease TypeRecognition MechanismCleavage PatternCofactor RequirementsPotential Similarity to LCL3
Type III Restriction EnzymesSite-specific, requires head-to-head orientation of sitesCleaves at defined distance from recognition siteATP-dependent, requires communication between sitesMay share similar site recognition and long-distance communication mechanisms
GajA EndonucleaseRecognizes specific sequence with GC-rich coreCreates double-strand breaksInhibited by nucleotides, no ATPase activityMay have similar nucleotide-sensing regulatory mechanisms
Type II Restriction EnzymesPalindromic recognition sequencesCleaves within or near recognition siteTypically requires Mg²⁺May share similar catalytic mechanism for phosphodiester bond hydrolysis

Understanding these similarities and differences is crucial for predicting LCL3's behavior and designing experiments to characterize its activity. Researchers should consider exploring:

  • The mechanism of substrate recognition and specificity

  • The role of protein-protein interactions in LCL3 function

  • Potential regulatory mechanisms that control its activity in vivo

What methods can be used to characterize the substrate specificity of LCL3?

Determining the substrate specificity of LCL3 is fundamental to understanding its biological function and potential applications. Researchers can employ several complementary approaches:

1. Systematic substrate screening:

  • Test LCL3 activity on a library of defined DNA substrates with varying sequences

  • Analyze cleavage efficiency to identify preferred recognition motifs

  • Use degenerate oligonucleotide libraries to determine the importance of each position in the recognition sequence

2. High-throughput sequencing approaches:

  • Digest genomic DNA with LCL3 and sequence the cleavage sites

  • Analyze the sequences flanking the cut sites to identify consensus motifs

  • Compare observed cleavage sites to predicted recognition sequences

3. Structure-based predictions:

  • Use homology modeling to predict LCL3 structure based on related endonucleases

  • Identify potential DNA-binding residues through structural analysis

  • Verify predictions through site-directed mutagenesis of key residues

By integrating these approaches, researchers can develop a comprehensive understanding of LCL3's substrate preferences and recognition mechanism. This knowledge is essential for predicting its biological roles and developing applications in molecular biology.

What are common challenges when working with recombinant endonucleases like LCL3?

Researchers working with recombinant endonucleases frequently encounter several challenges that can affect experimental outcomes. Understanding these issues and their solutions is crucial for successful research with LCL3:

1. Inconsistent enzymatic activity:

  • Challenge: Batch-to-batch variation in enzyme activity

  • Solution: Establish standardized activity assays; normalize enzyme amounts based on activity rather than protein concentration; include positive controls in each experiment

2. Non-specific cleavage:

  • Challenge: Activity at non-canonical sites under certain conditions

  • Solution: Optimize reaction conditions (salt concentration, pH, temperature); use competing non-specific DNA (e.g., poly dI-dC) to reduce non-specific binding

3. Inhibition by contaminants:

  • Challenge: Enzyme inhibition by buffer components or sample contaminants

  • Solution: Purify DNA substrates using methods that remove potential inhibitors; test different buffer compositions; include BSA to absorb inhibitors

4. Storage stability:

  • Challenge: Loss of activity during storage

  • Solution: Store as aliquots to avoid freeze-thaw cycles; add stabilizers like glycerol; validate activity periodically; consider lyophilization for long-term storage

5. Cofactor requirements:

  • Challenge: Unrecognized cofactor dependencies

  • Solution: Systematically test different metal ions and nucleotides; consider adding reducing agents to maintain cysteine residues in reduced state

How can researchers validate the specificity of LCL3 in complex experimental systems?

Validating the specificity of endonucleases like LCL3 in complex systems requires rigorous controls and multifaceted approaches:

1. Comparative analysis with known restriction enzymes:

  • Generate parallel digests with well-characterized enzymes

  • Compare cleavage patterns to establish relative specificity

  • Use double digests to confirm recognition site locations

2. Site-directed mutagenesis of substrate:

  • Systematically alter putative recognition sites in test substrates

  • Quantify changes in cleavage efficiency

  • Establish the contribution of each nucleotide to recognition

3. Competition assays:

  • Pre-incubate LCL3 with excess unlabeled competitor oligonucleotides

  • Test inhibition of labeled substrate cleavage

  • Use both specific and non-specific competitors to demonstrate selectivity

4. In silico prediction and validation:

  • Predict cleavage sites based on established recognition sequence

  • Test predictions experimentally

  • Refine recognition model based on experimental results

These approaches provide complementary lines of evidence to establish the true specificity of LCL3, enabling confident interpretation of experimental results and reliable application in research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.