Recombinant Vanderwaltozyma polyspora Solute carrier family 25 member 38 homolog (Kpol_1043p32)

Shipped with Ice Packs
In Stock

Description

Overview of Vanderwaltozyma polyspora

Vanderwaltozyma polyspora is a yeast species with significant evolutionary importance in fungal genomics research. This organism descended from an ancient whole-genome duplication event in the Saccharomyces lineage, making it valuable for studying gene duplication and functional divergence in yeasts . Though less extensively researched than the model organism Saccharomyces cerevisiae, V. polyspora provides important insights into yeast evolutionary biology and protein function conservation across species. The genome of V. polyspora DSM 70294 has been fully sequenced, revealing numerous genes with homology to functionally important proteins in better-characterized organisms, including various transporters and metabolic enzymes essential for cellular functions.

The Kpol_1043p32 gene, which encodes the Solute Carrier Family 25 Member 38 Homolog protein, represents one such conserved gene in V. polyspora. The conservation of this gene across related yeast species suggests it plays an important functional role in cellular metabolism, likely related to mitochondrial transport processes. Despite its apparent importance, detailed studies specifically focusing on this protein remain limited in the scientific literature, leaving many aspects of its exact biological function and regulation to be elucidated through further research.

The Solute Carrier Family 25

The Solute Carrier Family 25 (SLC25) encompasses a large group of nuclear-encoded transporters that primarily localize to the inner mitochondrial membrane in eukaryotic cells. These proteins serve critical roles in facilitating the transport of various metabolites, nucleotides, cofactors, and other essential molecules between the cytosol and mitochondrial matrix. The SLC25 family is extensive, comprising approximately 53 distinct members in humans and numerous homologs across other eukaryotic organisms, including yeasts. These transporters are fundamental to cellular metabolism because they enable the compartmentalized biochemical reactions that characterize mitochondrial function.

Within this family, Member 38 (SLC25A38) has been specifically identified in mammals as a glycine transporter in mitochondria with essential roles in heme biosynthesis. The importance of this transport function is underscored by the finding that mutations in human SLC25A38 are associated with congenital sideroblastic anemia, a serious blood disorder. The identification of a homologous protein (Kpol_1043p32) in V. polyspora suggests evolutionary conservation of this critical transport function across diverse eukaryotic species, highlighting its fundamental importance in cellular metabolism.

Gene Structure and Organization

The Kpol_1043p32 gene encodes the Solute Carrier Family 25 Member 38 Homolog in Vanderwaltozyma polyspora. Based on product information, this gene encodes a full-length protein consisting of 298 amino acids . While detailed information about the genomic organization and regulatory elements of this specific gene is limited in the available literature, it likely shares structural characteristics with other SLC25 family members from related yeast species. Typically, genes encoding mitochondrial carrier proteins contain multiple exons separated by introns, though the exact number and arrangement may vary among different species and family members.

The evolutionary conservation of the Kpol_1043p32 gene in V. polyspora strongly suggests functional importance for the organism's survival and metabolism. As with other genes encoding mitochondrial proteins, expression of Kpol_1043p32 is likely regulated in coordination with mitochondrial biogenesis and in response to changing metabolic demands. The gene may contain promoter elements responsive to factors involved in respiratory metabolism regulation, though specific studies examining the expression patterns and regulatory mechanisms of this particular gene have not been reported in the literature.

Protein Structure and Domains

The Kpol_1043p32 protein, as a member of the SLC25 family, is expected to share the characteristic structural features of mitochondrial carrier proteins. While no crystal structure has been reported specifically for this protein, structural predictions based on homology to other family members would suggest it contains six transmembrane α-helical domains organized into three similar repeating units. These transmembrane segments likely form a barrel-like structure creating a central pore through which substrate molecules can be transported across the inner mitochondrial membrane.

The protein's 298-amino acid sequence is consistent with the typical size range for mitochondrial carrier proteins, which generally contain between 280-340 amino acids . Both the N-terminal and C-terminal ends of the protein are predicted to face the intermembrane space, with three matrix-facing loops and two intermembrane space-facing loops connecting the transmembrane segments. These loop regions often contain charged residues that participate in substrate recognition and binding. The protein likely also contains the characteristic signature sequence motif P-X-[D/E]-X-X-[K/R] that appears in each of the three repeated domains in most SLC25 family members and plays a role in the conformational changes associated with transport.

Recombinant Expression Systems

The production of Recombinant Vanderwaltozyma polyspora Solute Carrier Family 25 Member 38 Homolog utilizes established expression systems optimized for membrane proteins. According to product information, the full-length protein (amino acids 1-298) is successfully expressed in Escherichia coli expression systems with an N-terminal His-tag . E. coli remains the preferred expression platform for this protein due to its rapid growth characteristics, cost-effectiveness, and ability to produce significant yields of recombinant protein. The successful expression in bacterial systems indicates that despite being a eukaryotic membrane protein, Kpol_1043p32 can be produced in functional form without the need for eukaryotic post-translational modifications.

Alternative expression platforms are also employed for producing this protein. Some manufacturers utilize cell-free expression systems, which can offer distinct advantages for membrane proteins that might otherwise be toxic to host cells or require specialized membrane insertion machinery . Cell-free systems can produce the protein in a more controlled environment, potentially improving folding and stability. The availability of multiple expression options provides researchers with flexibility in choosing the most appropriate source of recombinant protein based on their specific experimental requirements and applications.

Table 1: Expression Systems for Recombinant Kpol_1043p32 Production

Expression SystemAdvantagesReported PurityTagReference
E. coliHigh yield, cost-effective, rapid>90%N-terminal His
Cell-free expressionAvoids toxicity, rapid, controlled environment≥85%Various

Purification Methods

Purification of recombinant Kpol_1043p32 typically employs affinity chromatography strategies that leverage the engineered His-tag incorporated into the protein. The N-terminal histidine tag enables selective binding to metal chelate resins containing nickel or cobalt ions, allowing efficient separation of the target protein from the complex mixture of host cell proteins. This initial affinity purification step provides significant enrichment of the recombinant protein in a single procedure.

Following affinity chromatography, additional purification steps may be implemented to achieve higher purity levels. These might include size exclusion chromatography to remove aggregates and proteins of different molecular weights, or ion exchange chromatography to separate protein variants with different surface charge properties. The commercial recombinant protein is typically purified to greater than 90% homogeneity as assessed by SDS-PAGE analysis , while some alternative sources report a minimum purity of 85% .

After purification, the protein is typically supplied in lyophilized form to enhance stability during storage and transportation . Reconstitution protocols recommend using deionized sterile water to achieve a working concentration of 0.1-1.0 mg/mL. For long-term storage, the addition of 5-50% glycerol is recommended, with a default final concentration of 50% glycerol suggested by some manufacturers. This formulation helps prevent protein denaturation during freeze-thaw cycles and maintains functional integrity during extended storage at -20°C or -80°C.

Quality Control and Characterization

Quality control for recombinant Kpol_1043p32 involves multiple analytical methods to ensure identity, purity, and functional integrity. SDS-PAGE analysis serves as the primary method for assessing protein purity, with commercial standards typically requiring greater than 90% purity . This technique separates proteins based on molecular weight under denaturing conditions, allowing visualization of the target protein band and any contaminants that may be present. The distinct band corresponding to Kpol_1043p32 should appear at approximately 33-35 kDa, consistent with the predicted molecular weight for a 298-amino acid protein with an additional His-tag.

Additional characterization methods may include Western blotting using antibodies against the His-tag or against conserved epitopes of SLC25 family proteins. Mass spectrometry can provide precise molecular weight determination and verification of protein identity through peptide mapping. Circular dichroism spectroscopy might be employed to assess secondary structure content, particularly to confirm the predominantly α-helical structure expected for mitochondrial carrier proteins.

The stability and proper storage of the purified protein are critical considerations. The recommended storage buffer typically consists of a Tris/PBS-based formulation with 6% Trehalose at pH 8.0 . This buffer composition is designed to maintain protein stability by preventing aggregation and protecting against freeze-thaw damage. Manufacturers advise against repeated freezing and thawing of the protein, recommending instead that working aliquots be stored at 4°C for up to one week to maintain optimal activity and structural integrity.

Predicted Transport Activities

Based on its classification as a Solute Carrier Family 25 Member 38 homolog, the Kpol_1043p32 protein is annotated as a "Mitochondrial glycine transporter" . This functional annotation derives from homology to SLC25A38 proteins in mammals, which have been experimentally demonstrated to transport glycine across the inner mitochondrial membrane. In the context of cellular metabolism, this transport activity serves a critical role in heme biosynthesis, where glycine is required as a substrate for the first step of the pathway occurring in the mitochondrial matrix.

The transport mechanism likely involves facilitated diffusion or exchange of glycine for another amino acid or metabolite. As with other mitochondrial carriers, the process probably occurs through a conformational change in the protein that alternately exposes the substrate binding site to opposite sides of the membrane. This enables the controlled movement of glycine from the cytosol into the mitochondrial matrix, where it can participate in various metabolic pathways, particularly the synthesis of 5-aminolevulinic acid, the precursor for heme biosynthesis.

While direct experimental evidence confirming the transport activity of the V. polyspora Kpol_1043p32 protein is not available in the current literature, the high degree of sequence conservation within the SLC25A38 family strongly supports this functional assignment. Future studies incorporating the recombinant protein into liposomes for transport assays would be valuable for definitively confirming substrate specificity, determining kinetic parameters, and identifying potential inhibitors or regulators of transport activity.

Homology to Other Carrier Proteins

The Kpol_1043p32 protein shares significant sequence and predicted structural homology with SLC25 family members from diverse organisms. The conservation of this protein family across evolutionary distant species underscores the fundamental importance of mitochondrial glycine transport in eukaryotic metabolism. According to available information, homologs of this protein are found in various fungi including Saccharomyces cerevisiae (SCY_0799), Neosartorya fischeri (NFIA_103940), and Magnaporthe oryzae (MGG_05623), as well as in vertebrates including bovine (SLC25A38), rat (Slc25a38), and zebrafish (slc25a38a and slc25a38b) .

Table 2: Homologous SLC25A38 Proteins Across Species

SpeciesProtein NameGene SymbolNotesReference
Vanderwaltozyma polysporaSLC25 member 38 homologKpol_1043p32Putative mitochondrial glycine transporter
Saccharomyces cerevisiaeSLC25 member 38 homologSCY_0799Function similar to Kpol_1043p32
Neosartorya fischeriSLC25 member 38 homologNFIA_103940Annotated as mitochondrial carrier protein
Magnaporthe oryzaeSLC25 member 38 homologMGG_05623Plant pathogenic fungus
BovineSolute carrier family 25 member 38SLC25A38Vertebrate homolog
RatSolute carrier family 25 member 38Slc25a38Mammalian model organism
ZebrafishSolute carrier family 25 member 38-Aslc25a38aVertebrate model with two paralogs
ZebrafishSolute carrier family 25 member 38-Bslc25a38bSecond zebrafish paralog

Interestingly, some organisms like zebrafish possess two distinct paralogs (slc25a38a and slc25a38b) , suggesting potential functional specialization or tissue-specific expression patterns following gene duplication events. This diversification may reflect adaptations to specific metabolic requirements in different cell types or developmental stages. Comparative analysis of these homologs could provide valuable insights into the evolution of mitochondrial carrier proteins and the functional constraints that have shaped their sequence conservation across species.

Potential Role in Mitochondrial Function

In the context of yeast biology, this transporter may be particularly significant during respiratory growth conditions when the demand for heme-containing proteins increases substantially. Yeast species like V. polyspora undergo metabolic adaptations between fermentative and respiratory growth depending on nutrient availability and environmental conditions. During the shift to respiratory metabolism, increased mitochondrial activity necessitates enhanced expression of mitochondrial proteins, including transporters like Kpol_1043p32 that support essential biosynthetic pathways.

Disruption of mitochondrial glycine transport would likely have cascading effects on multiple cellular processes. In humans, mutations in SLC25A38 result in congenital sideroblastic anemia, characterized by defective heme biosynthesis and iron accumulation in mitochondria. By analogy, dysfunction of the Kpol_1043p32 protein in V. polyspora might be expected to impair heme-dependent processes, potentially leading to growth defects under respiratory conditions or altered sensitivity to oxidative stress. Experimental verification of these predictions through genetic manipulation studies would provide valuable insights into the precise physiological role of this mitochondrial carrier in yeast metabolism.

Available Reagents and Resources

Several commercial sources provide recombinant versions of the V. polyspora Kpol_1043p32 protein for research applications. These preparations typically include the full-length protein (amino acids 1-298) with an N-terminal His-tag, expressed in E. coli or cell-free systems and purified to greater than 85-90% homogeneity . The recombinant protein is generally supplied as a lyophilized powder that can be reconstituted according to experimental requirements, making it a versatile reagent for various biochemical and structural studies.

In addition to the recombinant protein itself, antibodies against SLC25A38 homologs from various species are commercially available . While antibodies specifically targeting the V. polyspora Kpol_1043p32 protein are not explicitly mentioned in the current literature, cross-reactivity with antibodies raised against homologous proteins might be expected due to sequence conservation within this protein family. Such immunological reagents could be valuable for detection, localization, and functional studies of this mitochondrial transporter.

The amino acid sequence of Kpol_1043p32 is well-documented in protein databases, with UniProt ID A7TIQ0 . This information facilitates computational analyses, structural modeling, and design of experimental approaches targeting specific domains or functional motifs within the protein. Together, these resources provide researchers with essential tools for investigating the biochemical properties and biological functions of this mitochondrial carrier protein.

Experimental Applications

The recombinant Kpol_1043p32 protein offers numerous experimental applications in both basic and applied research contexts. For functional characterization, the purified protein can be reconstituted into artificial liposomes to create proteoliposomes suitable for in vitro transport assays. Such systems allow measurement of substrate specificity, transport kinetics, and the effects of potential inhibitors or activators under controlled conditions. These studies can provide direct evidence for the predicted glycine transport activity and elucidate the molecular mechanisms underlying substrate recognition and translocation.

Structural biology approaches represent another important application area. While membrane proteins historically present challenges for structural determination, advances in techniques such as cryo-electron microscopy and X-ray crystallography have made such studies increasingly feasible. The availability of highly purified recombinant protein facilitates crystallization attempts or single-particle analysis aimed at determining the three-dimensional structure of Kpol_1043p32. Structural information would provide valuable insights into the substrate binding site, conformational changes during the transport cycle, and the molecular basis for substrate selectivity.

The recombinant protein can also serve as an antigen for generating specific antibodies, enabling immunolocalization studies to confirm its mitochondrial distribution in V. polyspora cells. Additionally, the protein might be used in protein-protein interaction studies to identify potential regulatory partners or in high-throughput screening assays for small molecules that modulate its transport activity. Such studies could reveal new aspects of mitochondrial carrier regulation and potentially identify compounds with applications in research or therapeutic development.

Comparative Genomics and Evolutionary Studies

The Kpol_1043p32 protein presents an excellent subject for comparative genomics and evolutionary studies focusing on mitochondrial carrier proteins. V. polyspora, as a yeast species that descended from an ancient whole-genome duplication event , offers insights into the fate of duplicated genes and their functional divergence or conservation. Comparison of Kpol_1043p32 with homologous proteins from other yeast species, particularly those that did not undergo whole-genome duplication, could reveal evolutionary patterns in sequence conservation, functional specialization, and selection pressures.

The presence of SLC25A38 homologs across diverse eukaryotic lineages, from fungi to vertebrates, suggests ancient evolutionary origins for this mitochondrial transport function. Phylogenetic analysis incorporating the V. polyspora protein alongside homologs from other species could help reconstruct the evolutionary history of this protein family and identify functionally important regions under strong selective constraints. Such studies contribute to our broader understanding of mitochondrial evolution and the adaptation of transport systems to different metabolic requirements across species.

Research comparing the biochemical properties of Kpol_1043p32 with those of homologs from other organisms, particularly those with experimentally confirmed functions like human SLC25A38, could also provide insights into functional conservation and divergence. Differences in substrate specificity, transport kinetics, or regulatory mechanisms might reflect adaptations to the specific metabolic needs of different organisms or cell types. These comparative approaches not only enhance our understanding of this particular protein family but also contribute to broader knowledge about the evolution of mitochondrial transport systems in eukaryotes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag is required, please specify this during your order to allow for preferential development.
Synonyms
Kpol_1043p32; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
Kpol_1043p32
Target Protein Sequence
MANTTKTRTHLIGGFFGGLTSAVALQPLDLLKTRIQQHQSQSIWSIVKNSKGFSELWRGT LPSAIRTSLGSALYLSSLNLMRTAIAKSKTNYNDGASKSSLLPKLTTYENLISGALARGA VGYMTMPVTVIKVRYESTLYSYTSLSQAVKHIYQSERIPGFFRGFGPTLVRDAPYSGIYV LLYEKAKEVVPKLLPRKFIKFDKHGSYLTSTSTLVNSTSAILSACLATTITAPFDTIKTR MQLEPKRYTNVWFTFKSIIKNEGILKLFSGLSMRLTRKALSAGIAWGIYEELIKLNKF
Uniprot No.

Target Background

Function

This recombinant Vanderwaltozyma polyspora Solute carrier family 25 member 38 homolog (Kpol_1043p32) is a mitochondrial glycine transporter that facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in supplying glycine for heme biosynthesis, specifically the initial enzymatic step: the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Kpol_1043p32 and what cellular functions is it associated with?

Kpol_1043p32 is a solute carrier family 25 member 38 homolog found in the yeast species Vanderwaltozyma polyspora. Based on homology to human SLC25A38, it is likely involved in mitochondrial metabolite transport . The protein appears to be a full-length protein of 298 amino acids that can be recombinantly expressed with a His-tag in E. coli expression systems . Functional characterization suggests it may play a role in mitochondrial processes similar to its human counterpart, which is known to be involved in glycine transport and the first step of heme synthesis . The protein belongs to the broader family of mitochondrial carrier proteins that facilitate the transport of various metabolites across the inner mitochondrial membrane.

How does V. polyspora's evolutionary history inform our understanding of Kpol_1043p32?

V. polyspora has a unique evolutionary history that provides important context for understanding mitochondrial proteins like Kpol_1043p32. The species possesses distinct nuclear genes for cytoplasmic and mitochondrial functions, as demonstrated by its alanyl-tRNA synthetase genes (ALA1 and ALA2) . Phylogenetic analysis shows that all yeast AlaRS genes, regardless of their cellular localization, are of mitochondrial origin, suggesting ancient genetic recombination events . This evolutionary pattern indicates that mitochondrial carrier proteins in V. polyspora, including Kpol_1043p32, may have undergone similar evolutionary processes, potentially acquiring specialized functions through gene duplication and subfunctionalization. Understanding this evolutionary context is crucial for interpreting the functional role of Kpol_1043p32 in relation to its homologs in other species.

What expression patterns does Kpol_1043p32 show in V. polyspora?

While specific expression data for Kpol_1043p32 is not directly provided in the available research, we can draw insights from expression studies of other V. polyspora genes. For instance, both ALA1 and ALA2 genes in V. polyspora are actively expressed with comparable efficiencies as demonstrated by semiquantitative RT-PCR . Quantitative real-time RT-PCR revealed that VpALA1 had approximately twice the transcriptional efficiency of VpALA2 . Similar experimental approaches can be employed to investigate Kpol_1043p32 expression patterns. Researchers should utilize gene-specific primers designed to complementary sequences of Kpol_1043p32 mRNA and perform both semiquantitative and quantitative RT-PCR to determine relative expression levels across different growth conditions and developmental stages. Multiple PCR cycle numbers should be used for each cDNA preparation to ensure reliable data .

How do the substrate specificities of Kpol_1043p32 compare to its homologs in other yeast species?

The substrate specificity of Kpol_1043p32 can be investigated using methodologies similar to those employed for other mitochondrial carrier proteins. Based on the functional characterization of V. polyspora AlaRS enzymes, which showed similar tRNA specificity despite different cellular localizations , we can hypothesize that Kpol_1043p32 might maintain substrate specificity similar to its homologs while potentially adapting to specific cellular compartments. To test this experimentally, researchers should purify recombinant Kpol_1043p32-His6 using Ni-NTA column chromatography to homogeneity . Substrate transport assays can be performed using reconstituted proteoliposomes containing the purified protein. Comparative analysis with homologs from related yeast species like S. cerevisiae would provide insights into evolutionary conservation or divergence of substrate specificities. Additionally, site-directed mutagenesis of conserved residues can help identify amino acids critical for substrate recognition and transport.

What are the structural determinants of Kpol_1043p32 localization to the mitochondria?

The localization of Kpol_1043p32 to mitochondria likely depends on specific structural elements within the protein sequence. Drawing from studies on V. polyspora AlaRS proteins, we know that localization can determine protein function in vivo . For mitochondrial proteins, N-terminal targeting sequences typically direct proteins to the mitochondrial matrix. To identify these determinants in Kpol_1043p32, researchers should perform detailed sequence analysis to predict potential mitochondrial targeting sequences. Experimental verification can be conducted by creating fusion constructs with reporter proteins (such as GFP) containing full-length Kpol_1043p32 or truncated versions with systematic deletions of potential targeting sequences. These constructs should be expressed in yeast cells, followed by subcellular fractionation and fluorescence microscopy to determine localization patterns. Additionally, cross-species complementation assays in knockout strains can provide functional evidence for proper localization, similar to the approaches used for AlaRS genes .

What is the role of Kpol_1043p32 in mitochondrial metabolite homeostasis and its potential connection to heme synthesis?

Based on homology to human SLC25A38, which is involved in glycine transport and heme synthesis , Kpol_1043p32 may play a critical role in mitochondrial metabolite homeostasis in V. polyspora. To investigate this function, researchers should design experiments that measure glycine transport in isolated mitochondria from wild-type and Kpol_1043p32 knockout V. polyspora strains. Additionally, metabolomic profiling of these strains under various growth conditions could reveal alterations in metabolite levels associated with Kpol_1043p32 function. The connection to heme synthesis can be assessed by measuring heme levels and the activities of heme biosynthetic enzymes in these strains. Genetic interaction studies with genes involved in heme biosynthesis would further elucidate functional relationships. Additionally, researchers should investigate whether mutations in Kpol_1043p32 lead to phenotypes similar to those observed in human SLC25A38 mutations, such as sideroblastic anemia-like conditions in yeast .

What are the optimal conditions for expressing and purifying recombinant Kpol_1043p32?

For optimal expression and purification of recombinant Kpol_1043p32, the following methodology is recommended based on successful approaches with similar proteins:

  • Expression System: Use E. coli BL21(DE3) or a derivative strain transformed with a plasmid containing the Kpol_1043p32 gene with a C-terminal His-tag .

  • Culture Conditions:

    • Grow bacterial cultures in LB medium supplemented with appropriate antibiotics

    • Induce protein expression with 0.5-1.0 mM IPTG when OD600 reaches 0.6-0.8

    • Continue incubation at a reduced temperature (16-20°C) for 16-18 hours to enhance soluble protein production

  • Cell Lysis and Protein Extraction:

    • Harvest cells by centrifugation and resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 10% glycerol, 1 mM DTT, and protease inhibitors)

    • Lyse cells using sonication or a French press

    • Clarify lysate by centrifugation at 15,000 × g for 30 minutes at 4°C

  • Protein Purification:

    • Use Ni-NTA affinity chromatography for initial purification

    • Apply clarified lysate to a pre-equilibrated Ni-NTA column

    • Wash with buffer containing 20-50 mM imidazole

    • Elute protein with buffer containing 250-300 mM imidazole

    • Further purify using size exclusion chromatography if higher purity is required

  • Quality Control:

    • Assess protein purity by SDS-PAGE

    • Confirm identity by Western blotting with anti-His antibodies

    • Verify protein functionality through appropriate activity assays

This protocol should yield pure, functionally active Kpol_1043p32 suitable for subsequent biochemical and structural analyses.

How can researchers generate and validate knockout or knockdown models of Kpol_1043p32 in V. polyspora?

Generating and validating knockout or knockdown models of Kpol_1043p32 in V. polyspora requires a methodical approach:

  • Knockout Strategy:

    • Design homologous recombination cassettes containing a selectable marker (e.g., URA3) flanked by sequences homologous to regions upstream and downstream of the Kpol_1043p32 gene

    • Transform V. polyspora with the linear DNA fragment using lithium acetate/PEG method

    • Select transformants on appropriate selective media

    • Verify gene deletion by PCR with primers outside the integration site

  • CRISPR-Cas9 Approach:

    • Design guide RNAs targeting Kpol_1043p32

    • Co-transform cells with plasmids expressing Cas9, guide RNA, and a repair template containing a selectable marker

    • Select and screen transformants for successful gene editing

  • RNA Interference for Knockdown:

    • Construct plasmids expressing double-stranded RNA corresponding to Kpol_1043p32

    • Transform V. polyspora and select transformants

    • Verify knockdown efficiency by RT-PCR and Western blot

  • Validation of Models:

    • Confirm absence of Kpol_1043p32 mRNA by RT-PCR using gene-specific primers similar to the approach used for ALA1/ALA2 expression analysis

    • Verify protein absence using Western blotting with specific antibodies

    • Perform phenotypic characterization including growth rate analysis on different carbon sources

    • Assess mitochondrial function through respiratory capacity measurements

  • Complementation Assays:

    • Reintroduce Kpol_1043p32 on a plasmid to rescue the knockout phenotype

    • Create cross-species complementation assays with homologs from related species to assess functional conservation, similar to the approach used for AlaRS genes

This comprehensive approach ensures reliable generation and validation of knockout/knockdown models for functional studies of Kpol_1043p32.

What techniques are most effective for studying Kpol_1043p32 interactions with other proteins in the mitochondrial transport network?

Multiple complementary techniques should be employed to comprehensively study Kpol_1043p32 interactions within the mitochondrial transport network:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged Kpol_1043p32 in V. polyspora

    • Isolate mitochondria and solubilize membrane proteins with mild detergents

    • Perform immunoprecipitation with antibodies against the epitope tag

    • Identify co-precipitated proteins by mass spectrometry

    • Validate interactions by reverse Co-IP

  • Proximity-based Labeling:

    • Generate fusion constructs of Kpol_1043p32 with BioID or APEX2

    • Express in V. polyspora and allow proximity-dependent biotinylation

    • Isolate biotinylated proteins using streptavidin beads

    • Identify interacting proteins by mass spectrometry

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use Kpol_1043p32 as bait to screen for interacting proteins

    • Focus particularly on mitochondrial proteins and other transport proteins

    • Validate positive interactions by co-expression and co-localization studies

  • Blue Native PAGE:

    • Isolate mitochondria and solubilize membrane complexes with mild detergents

    • Separate protein complexes by blue native PAGE

    • Identify complex components by mass spectrometry or Western blotting

    • Assess changes in complex formation in Kpol_1043p32 knockout strains

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fusion constructs of Kpol_1043p32 and potential interacting partners with fluorescent proteins

    • Express in yeast cells and analyze FRET signals to detect protein-protein interactions in vivo

    • Quantify interaction strength through FRET efficiency measurements

These methods provide complementary approaches to identify and characterize protein-protein interactions of Kpol_1043p32, revealing its functional role within the mitochondrial transport network.

How should researchers analyze evolutionary relationships between Kpol_1043p32 and its homologs in other species?

To comprehensively analyze evolutionary relationships of Kpol_1043p32, researchers should employ the following systematic approach:

  • Sequence Retrieval and Multiple Sequence Alignment:

    • Retrieve Kpol_1043p32 homolog sequences from diverse species spanning all three domains of life (Bacteria, Archaea, and Eukarya)

    • Create multiple sequence alignments using programs like MUSCLE or CLUSTAL

    • Reduce alignments to core active sites to eliminate bias, as demonstrated in the phylogenetic analysis of AlaRS genes

  • Phylogenetic Tree Construction:

    • Apply multiple tree-building methods including:

      • Neighbor-joining method (used for AlaRS phylogeny)

      • Maximum likelihood

      • Bayesian inference

    • Use appropriate substitution models based on likelihood ratio tests

    • Evaluate tree reliability through bootstrap analysis (1000 replicates)

  • Domain Architecture Analysis:

    • Identify conserved domains and motifs across homologs

    • Map functional regions onto the phylogenetic tree to trace evolutionary changes

    • Analyze correlation between sequence conservation and functional importance

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify sites under positive, neutral, or purifying selection

    • Identify potential lineage-specific adaptive evolution

    • Correlate selection patterns with known functional sites

  • Reconciliation with Species Phylogeny:

    • Compare gene tree with species tree to identify potential horizontal gene transfer, gene duplication, or gene loss events

    • Analyze synteny relationships to understand genomic context evolution

    • Reconstruct ancestral sequences at key nodes of the phylogenetic tree

This methodical approach, similar to that used for AlaRS phylogeny , will provide robust insights into the evolutionary history of Kpol_1043p32 and its relationship to homologs across species.

What statistical approaches are most appropriate for analyzing functional data from Kpol_1043p32 transport assays?

When analyzing functional data from Kpol_1043p32 transport assays, researchers should employ the following statistical approaches:

  • Kinetic Parameter Estimation:

    • Use non-linear regression to fit transport data to appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Calculate key parameters including Km, Vmax, and Hill coefficient

    • Determine confidence intervals for each parameter using profile likelihood or bootstrap methods

    • Compare parameters across experimental conditions using statistical tests

  • Comparative Analysis Between Conditions:

    • For comparing transport rates under different conditions:

      • Use ANOVA followed by post-hoc tests (Tukey or Bonferroni) for multiple comparisons

      • Apply paired t-tests for before/after comparisons on the same samples

      • Use non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) when assumptions of normality are not met

  • Time Series Analysis:

    • Apply repeated measures ANOVA for time-dependent transport studies

    • Use mixed-effects models to account for both fixed and random effects

    • Perform curve fitting to determine rate constants for uptake or release kinetics

  • Inhibition Studies:

    • Use competitive, non-competitive, or mixed inhibition models to analyze inhibitor effects

    • Calculate IC50 and Ki values with appropriate confidence intervals

    • Apply Schild analysis for competitive antagonists

  • Quality Control and Validation:

    • Perform power analysis to determine appropriate sample sizes

    • Validate model assumptions (normality, homoscedasticity)

    • Use residual analysis to detect systematic deviations from models

    • Apply bootstrapping or jackknife procedures to assess result robustness

    • Include positive and negative controls in statistical comparisons

These approaches ensure rigorous analysis of transport data, allowing reliable interpretation of Kpol_1043p32 functional characteristics across various experimental conditions.

How can researchers integrate transcriptomic, proteomic, and metabolomic data to develop a comprehensive model of Kpol_1043p32 function?

Integrating multi-omics data requires a systematic approach to develop a comprehensive functional model of Kpol_1043p32:

  • Data Collection and Normalization:

    • Generate transcriptomic data using RNA-seq from wild-type and Kpol_1043p32 knockout V. polyspora under various conditions

    • Perform proteomic analysis using LC-MS/MS on the same samples

    • Conduct metabolomic profiling focusing on mitochondrial metabolites

    • Apply appropriate normalization methods to each data type (e.g., RPKM/FPKM for RNA-seq, internal standards for metabolomics)

  • Differential Analysis:

    • Identify differentially expressed genes, proteins, and metabolites between wild-type and knockout strains

    • Use tools like DESeq2 for transcriptomics, MaxQuant for proteomics, and XCMS for metabolomics

    • Apply multiple testing correction (e.g., Benjamini-Hochberg) to control false discovery rate

  • Pathway Enrichment Analysis:

    • Perform Gene Ontology and KEGG pathway enrichment analysis on differentially expressed genes and proteins

    • Identify metabolic pathways affected by Kpol_1043p32 deletion

    • Focus particularly on mitochondrial pathways and those related to functions of solute carrier family 25

  • Network Analysis and Data Integration:

    • Construct correlation networks between transcripts, proteins, and metabolites

    • Apply techniques such as Weighted Gene Co-expression Network Analysis (WGCNA)

    • Use integrative approaches like Multi-Omics Factor Analysis (MOFA) or Similarity Network Fusion (SNF)

    • Implement Bayesian networks to model causal relationships

  • Validation of Integrated Model:

    • Test model predictions through targeted experiments

    • Use computational simulations to predict system behavior under various conditions

    • Iteratively refine the model based on new experimental data

This comprehensive integration approach, applied similarly to understand the functional context of genes like ALA1 and ALA2 , will yield a robust model of Kpol_1043p32 function within the broader cellular and mitochondrial context.

What are the most promising future research directions for Kpol_1043p32?

The most promising future research directions for Kpol_1043p32 include several key areas that build upon current understanding while addressing important knowledge gaps:

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of Kpol_1043p32 using X-ray crystallography or cryo-EM

    • Conduct molecular dynamics simulations to understand transport mechanisms

    • Investigate conformational changes during substrate transport

    • Develop structure-based models for rational design of specific inhibitors or activators

  • Comparative Functional Analysis:

    • Perform detailed functional comparisons between Kpol_1043p32 and its homologs across diverse yeast species

    • Investigate whether Kpol_1043p32 can complement defects in human SLC25A38 in appropriate model systems

    • Explore the evolutionary constraints and functional adaptations of mitochondrial carrier proteins

  • Systems Biology Integration:

    • Develop comprehensive models integrating Kpol_1043p32 function with global cellular metabolism

    • Map metabolic flux changes in response to Kpol_1043p32 perturbation

    • Investigate synthetic genetic interactions to identify functional redundancy or pathway connections

  • Translational Research Opportunities:

    • Explore Kpol_1043p32 as a model for understanding human mitochondrial transport disorders

    • Investigate potential applications in metabolic engineering of yeast for biotechnology

    • Develop Kpol_1043p32 variants with enhanced or altered transport properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.