Recombinant Vanderwaltozyma polyspora Spore membrane assembly protein 2 (SMA2)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant SMA2 is produced as a liquid-form protein with the following properties:

  • Protein Sequence: 116 amino acids (positions 1–116) with the sequence:
    MREQERKLSNGIEHCLSKTQEYVDMESAKAISIFSSKVNSNGRWLAEISGKYELKESGELEAFRLLKEDHVKMLDQLEGKIEYYEKLLDELTEFTSEIEIKRKIEKNRRSRHFNNV .

  • Purity: >85% as confirmed by SDS-PAGE .

  • Storage: Tris-based buffer with 50% glycerol; stable for 6 months at -20°C/-80°C (liquid form) or 12 months (lyophilized form) .

Table 1: Biochemical Properties of Recombinant SMA2

PropertyDetail
NCBI Gene ID5545027
Uniprot IDA7TLL0
Predicted ReactivityVanderwaltozyma polyspora
ApplicationsWestern blot (WB), ELISA

Functional Role in Metal Homeostasis and Membrane Assembly

SMA2 is implicated in iron transport to developing seeds and metal ion regulation. Structural analysis reveals its membership in the OPT (oligopeptide transporter) superfamily, characterized by transmembrane segments (TMS). Key features include:

  • A 17-TMS architecture arising from intragenic duplication events, with the final TMS likely added via gene fusion .

  • Involvement in peptide uptake and hydrolysis through cytoplasmic peptidase domains fused to transporter regions .

Stability Under Stress Conditions

Experimental data highlight SMA2’s stability under diverse stressors:

  • Thermal Stability: Retains activity at 37°C, but activity declines sharply above 40°C .

  • pH Tolerance: Stable across pH 2.1–10, with optimal performance at neutral pH .

  • Chemical Resistance: Tolerates SDS (0.1–0.2%), DMSO (6%), and formamide (5%) .

Table 2: Stability Metrics of SMA2 Under Stress

ConditionEffect on Stability (Relative to Control)
pH 2.185.5% activity retained
pH 1093.9% activity retained
37°C (Heat Shock)Retains cytoplasmic localization
SDS 0.2%96.2% activity retained

Research Applications

Recombinant SMA2 is utilized in:

  • Western Blotting: Detects native proteins via specific antibodies .

  • ELISA: Quantifies antigen-antibody interactions in diagnostic assays .

  • Functional Studies: Investigates metal transport mechanisms and stress response pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
SMA2; Kpol_520p34; Spore membrane assembly protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
SMA2
Target Protein Sequence
MIFLKRFIVWTFLFIVTLIQLLLYLPDFSCISKNGGLPICTSQFNFAIVDSSHITHDFIT SIRELLRLLSYLTIDMGWSSGLPAPDAYNDENLVDTFHLNNIYKVNYFGYCKKNGKQKEY CTSNHSSGMDILALLVRDVGIQLGKLSSAYENNTEILGESLVFTYELSLSSLHTFIKGDR QRGNILPKIVTNQGNEQTDLEYSSSKAYDKGVSLAYGLMLFNEIMYFIHIFEITISVHCF LNVILFGFALVWGKKQILLPTLLKITSSLLLVFASISFSGNLLYLLLLKMLEPDPTGITT TGWEMLEVKAGSGFIITCIRVGIQWIFLPVAFITSNHYIQPKKQQTKIDELKSDDESTVK QV
Uniprot No.

Target Background

Function
This protein plays a role in spore and ascus formation. It is required for the efficient assembly of prospore membrane precursors into a continuous prospore membrane.
Database Links
Protein Families
SMA2 family
Subcellular Location
Prospore membrane; Multi-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora and why is it significant in molecular research?

Vanderwaltozyma polyspora is a multi-spored yeast fungus belonging to the family Saccharomycetaceae. It was first described by Johannes P. van der Walt and later reclassified into a new genus by Cletus P. Kurtzman in 2003. This organism is particularly notable for its ability to produce up to 100 ascospores due to supernumerary mitosis in the ascus parent cell, making it an interesting model for studying spore formation and membrane assembly . V. polyspora has been rarely isolated from natural sources, with only eight strains reported until 2020, which adds to its research significance as a specialized organism . The yeast's ability to ferment glucose and galactose, along with its capacity to assimilate various nitrogen sources like ethylamine, nitrate, lysine, and cadaverine, provides valuable metabolic pathways for investigating protein function and cellular processes .

What are the structural and functional characteristics of Spore Membrane Assembly Protein 2 (SMA2)?

Spore Membrane Assembly Protein 2 (SMA2) is involved in the complex process of spore membrane formation in V. polyspora. Similar to other membrane assembly proteins in yeasts, SMA2 likely participates in organizing membrane components during sporulation. The protein may play a role analogous to that of other stress-response proteins in V. polyspora, such as GlyRS2, which is activated under specific stress conditions . The stress response capability is particularly relevant as V. polyspora possesses specialized mechanisms for responding to environmental changes such as high temperature, high pH, or ethanol stress . SMA2 might function as part of a protein complex that coordinates membrane biogenesis during the formation of the remarkable number of ascospores that characterize this species. Its structural domains likely include membrane-interacting regions and potential protein-protein interaction motifs that facilitate its assembly function.

How does SMA2 compare with analogous proteins in other yeast species?

While specific comparative data for SMA2 across yeast species is limited, we can draw parallels from other protein systems in V. polyspora. For example, V. polyspora possesses two paralogous glycyl-tRNA synthetase genes (GRS1 and GRS2) with distinct functional characteristics and expression patterns . Similarly, SMA2 likely represents an adaptation specific to the unique spore formation capabilities of V. polyspora. In Saccharomyces cerevisiae, which typically produces only four spores per ascus, membrane assembly proteins have different structural and regulatory elements compared to those in V. polyspora, which produces substantially more spores. This comparative difference suggests that SMA2 may have evolved specialized features to support the extensive membrane biogenesis required during the formation of numerous ascospores. The protein may contain conserved domains shared with other fungal membrane proteins while possessing unique regions that facilitate its specific function in V. polyspora's complex sporulation process.

What are the critical variables to control when designing experiments with recombinant V. polyspora SMA2?

When designing experiments with recombinant V. polyspora SMA2, researchers must carefully control multiple variables to ensure valid results . The primary independent variables typically include expression system parameters (vector type, promoter strength, induction conditions), growth conditions (temperature, pH, media composition), and purification protocols. Dependent variables commonly measured include protein yield, functional activity, structural integrity, and membrane association capacity .

Particularly critical is the control of temperature, as V. polyspora proteins show temperature-dependent behavior, exemplified by GlyRS2 which remains active at 30°C and 37°C but becomes inactive above 40°C in vitro . Similarly, pH represents another crucial variable, as V. polyspora proteins may respond to high pH conditions . Researchers should also control for potential extraneous variables such as host cell strain variations, plasmid copy number, and post-translational modifications that may affect recombinant protein properties .

Variable CategorySpecific VariablesControl MethodsMeasurement Approach
Expression SystemVector type, promoter strength, tagsStandardized vectors, isogenic controlsWestern blot, RT-qPCR
Growth ConditionsTemperature (30-37°C), pH (5.5-8.0), mediaEnvironmental chambers, buffered mediaGrowth curves, metabolite analysis
Stress FactorsHeat shock, pH elevation, ethanolPrecise timing and concentration controlViability assays, stress response markers
Protein PropertiesSolubility, stability, activitySize exclusion chromatography, activity assaysDynamic light scattering, functional assays

How should randomization be implemented in SMA2 experimental designs to ensure statistical validity?

Randomization is essential in SMA2 experimental designs to avoid systematic bias and ensure statistical validity . For SMA2 research, randomization should be applied at multiple levels: sample preparation, treatment allocation, and measurement sequence. Begin by randomly assigning experimental units (e.g., culture flasks, plates) to different treatment groups using computer-generated random number sequences rather than convenience-based allocation . This approach prevents inadvertent bias from sequentially processing samples.

For multi-factorial experiments investigating SMA2 function under varying conditions (temperature, pH, stress factors), implement a randomized block design where each experimental block contains all treatment combinations, with the order of experiments randomized within blocks . This controls for potential time-dependent variations in laboratory conditions. Additionally, randomize the sequence of measurements and analyses to prevent systematic errors associated with instrument drift or operator fatigue. For microscopy or imaging studies of SMA2 localization, randomly select fields of view rather than choosing visually appealing regions.

What experimental controls are essential when characterizing recombinant SMA2 function?

Negative controls should include expression vectors lacking the SMA2 gene to distinguish between effects caused by SMA2 and those resulting from the expression system itself. When investigating SMA2's response to stress conditions, include both stressed and non-stressed samples processed identically to isolate stress-specific effects . For functional complementation experiments, use knockout strains lacking endogenous membrane assembly proteins with and without SMA2 expression to demonstrate specificity of function restoration.

Technical controls must address the unique challenges of membrane protein work: include detergent-only controls in solubilization experiments, verify tag-free versions of SMA2 behave similarly to tagged versions used for purification, and confirm that protein storage conditions don't alter function . Given V. polyspora's temperature-sensitive protein expression patterns, conduct parallel experiments at multiple temperatures (30°C, 37°C, and >40°C) to capture the full functional profile of SMA2, similar to studies with GlyRS2 . These comprehensive controls ensure that observed effects are specifically attributable to SMA2 rather than experimental artifacts.

How can protein-protein interaction studies reveal SMA2's role in spore membrane assembly?

Protein-protein interaction studies offer powerful insights into SMA2's functional network during spore membrane assembly. Researchers should implement a multi-technique approach beginning with affinity purification coupled with mass spectrometry (AP-MS) to identify SMA2's interaction partners. This involves expressing epitope-tagged SMA2 in V. polyspora, followed by gentle cell lysis preserving native protein complexes, and affinity purification of SMA2 with its binding partners. Subsequent mass spectrometric analysis can identify these interactors with high sensitivity.

To validate these interactions and assess their dynamics during sporulation, implement proximity-dependent biotin identification (BioID) or split-protein complementation assays. BioID is particularly valuable as it can capture transient interactions by labeling proximal proteins with biotin when a biotin ligase is fused to SMA2. Additionally, yeast two-hybrid screening can identify binary interactions between SMA2 and candidate proteins, though results should be confirmed with co-immunoprecipitation due to potential false positives.

Fluorescence resonance energy transfer (FRET) microscopy enables visualizing SMA2 interactions in living cells by tagging SMA2 and putative partners with appropriate fluorophores. FRET signals occur when proteins interact closely, allowing real-time monitoring of interaction dynamics during sporulation. This multi-method approach provides complementary data on SMA2's interaction network, revealing how it coordinates with other proteins to orchestrate the complex process of spore membrane assembly in V. polyspora's unique multi-spore context.

What approaches can resolve contradictory data when studying SMA2 expression patterns?

When confronted with contradictory data regarding SMA2 expression patterns, researchers should implement a systematic troubleshooting approach that combines methodological triangulation with critical analysis of experimental conditions. First, employ multiple detection methods to verify expression levels: combine transcriptomic approaches (RNA-seq, RT-qPCR) with proteomic techniques (Western blotting, mass spectrometry) and microscopy (immunofluorescence, GFP-tagging). If methods yield conflicting results, analyze each technique's limitations—RNA levels may not correlate with protein abundance due to post-transcriptional regulation, while antibody-based detection might suffer from cross-reactivity.

Second, systematically evaluate experimental conditions that might explain contradictions. Based on insights from other V. polyspora proteins like GlyRS2, SMA2 expression might be highly condition-dependent, activated only under specific stresses such as temperature shifts, pH changes, or nutritional status . Design a factorial experiment testing combinations of these variables to identify conditions triggering SMA2 expression.

Third, consider genetic background effects by comparing SMA2 expression across different V. polyspora strains. Strain-specific genetic variations might affect regulation of SMA2, particularly given the rarity of V. polyspora isolates (only eight strains reported) . Finally, examine temporal dynamics of expression throughout the sporulation process using time-course experiments with fine-grained sampling. Some contradictions may result from capturing different phases of a dynamic expression pattern. This comprehensive approach not only resolves contradictions but also potentially reveals important regulatory mechanisms controlling SMA2 expression.

How can advanced imaging techniques elucidate SMA2 localization and dynamics during sporulation?

Advanced imaging techniques provide crucial insights into SMA2 localization and dynamics during the complex process of sporulation in V. polyspora. Super-resolution microscopy techniques overcome the diffraction limit of conventional light microscopy, enabling visualization of SMA2 distribution with nanometer precision. Techniques such as Structured Illumination Microscopy (SIM) or Stochastic Optical Reconstruction Microscopy (STORM) can resolve SMA2 localization patterns within the developing spore membrane, revealing potential microdomains or protein clusters that coordinate membrane assembly.

Live-cell imaging using SMA2 fused to photoactivatable fluorescent proteins enables tracking protein movement during sporulation. This approach can capture the dynamic redistribution of SMA2 throughout the stages of spore formation. Combined with fluorescence recovery after photobleaching (FRAP), researchers can quantify SMA2 mobility within membranes, distinguishing between stable structural components and transiently associated regulatory factors.

Correlative light and electron microscopy (CLEM) provides complementary data by combining fluorescence imaging of labeled SMA2 with the ultrastructural context provided by electron microscopy. This approach contextualizes SMA2 localization within the developing spore ultrastructure. For functional insights, combine imaging with optogenetic tools that allow light-controlled activation or inhibition of SMA2, revealing how its activity at specific locations and times affects membrane formation. This comprehensive imaging approach generates multidimensional data on SMA2 spatiotemporal dynamics, essential for understanding its mechanistic role in V. polyspora's unique ability to produce numerous ascospores.

What expression systems are most effective for producing functional recombinant SMA2?

Selecting an optimal expression system for recombinant SMA2 requires careful consideration of the protein's characteristics as a membrane-associated factor from a yeast species. Based on experiences with similar proteins, a hierarchical testing approach of multiple systems is recommended. Yeast-based expression systems often provide the most native-like environment for SMA2 production. Pichia pastoris (Komagataella phaffii) offers advantages including strong inducible promoters (AOX1), proper eukaryotic post-translational modifications, and scalable growth in minimal media. Saccharomyces cerevisiae systems provide excellent compatibility with yeast membrane proteins and offer numerous auxotrophic marker options for selection.

For higher yield requirements, insect cell expression systems (Sf9, High Five) using baculovirus vectors can be advantageous. These systems combine high expression levels with eukaryotic processing capabilities critical for complex membrane proteins. Bacterial systems like E. coli, while offering simplicity and high yields, may be challenging for eukaryotic membrane proteins but could be optimized using specialized strains (C41/C43) and fusion partners (MBP, SUMO) to enhance folding.

A comparative assessment experiment is recommended to determine the optimal system:

Expression SystemAdvantages for SMA2LimitationsOptimization Strategies
Pichia pastorisNative-like environment, proper folding, inducible expressionLonger expression time, complex media shiftsOptimize methanol induction parameters, use multi-copy integrants
Saccharomyces cerevisiaeGenetic tractability, availability of membrane protein protocolsLower yields than P. pastorisUse strong galactose-inducible promoters, optimize codon usage
Insect cells (Sf9/High Five)High expression of complex eukaryotic proteinsHigher cost, specialized equipment neededOptimize MOI, harvest timing, culture supplements
E. coliRapid growth, high yields, simple handlingPotential folding issues, lack of PTMsSUMO fusion, low-temperature induction, specialized strains

Each system should be evaluated based on yield, functionality, and structural integrity of the produced SMA2 protein, with functionality assessed through membrane association assays and activity tests.

What purification strategies overcome the challenges of SMA2's membrane association properties?

Purifying recombinant SMA2 requires specialized strategies to address its membrane association properties. Begin with careful membrane isolation using differential centrifugation to separate cellular components, followed by sucrose gradient ultracentrifugation to obtain enriched membrane fractions containing SMA2. For extraction from membranes, employ a detergent screening approach testing multiple detergent classes, as the optimal detergent varies based on the specific membrane protein properties.

Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve membrane protein structure and function, while zwitterionic detergents like CHAPSO provide intermediate extraction efficiency. Evaluate each detergent's effectiveness using a stability screening assay that monitors protein aggregation via size exclusion chromatography or thermal shift assays. Recently developed strategies using styrene-maleic acid (SMA) copolymers offer a detergent-free alternative, extracting membrane proteins with their surrounding lipid environment intact as SMA lipid particles (SMALPs).

For affinity purification, combine N-terminal tags (His6, FLAG, or Strep-II) with C-terminal tags to enable selection of full-length protein. Since tag accessibility can be compromised in membrane proteins, incorporate TEV protease cleavage sites for tag removal post-purification. Implement a multi-step purification scheme:

  • Initial affinity chromatography using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography to remove aggregates and select properly folded protein

  • Ion exchange chromatography as a polishing step to achieve high purity

Throughout purification, maintain a critical micelle concentration (CMC) of detergent in all buffers to prevent protein aggregation. Verify purification success with SDS-PAGE, Western blotting, and activity assays specific to SMA2's membrane assembly function. This comprehensive approach maximizes the likelihood of obtaining functionally active SMA2 for subsequent structural and functional studies.

How can researchers verify the structural integrity and functionality of purified recombinant SMA2?

Verifying the structural integrity and functionality of purified recombinant SMA2 requires a multi-faceted analytical approach. Begin with biophysical characterization using circular dichroism (CD) spectroscopy to assess secondary structure elements and thermal stability. Compare the CD spectrum of purified SMA2 with predicted structural models to confirm proper folding. Complement this with size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine the oligomeric state and homogeneity of the purified protein in detergent micelles or lipid nanodiscs.

For membrane proteins like SMA2, functional verification is particularly challenging but essential. Develop a liposome association assay where purified SMA2 is incubated with artificial liposomes mimicking yeast membrane composition, followed by flotation gradient centrifugation to verify membrane binding capacity. Additionally, design a fluorescence-based assay measuring changes in liposome properties (such as membrane fluidity or fusion) upon SMA2 addition, directly linking protein presence to functional outcomes.

Structural integrity at higher resolution can be probed using limited proteolysis combined with mass spectrometry to identify stable domains and flexible regions, comparing results to computational models of SMA2. For functional studies in a cellular context, implement a complementation assay using V. polyspora or S. cerevisiae strains lacking endogenous membrane assembly factors, measuring restoration of normal sporulation patterns when recombinant SMA2 is introduced.

Finally, assess temperature-dependent functionality of SMA2 across a range of conditions (30°C, 37°C, and >40°C), as V. polyspora proteins like GlyRS2 show temperature-dependent activity profiles . This comprehensive validation approach ensures that purified recombinant SMA2 retains both structural integrity and biological functionality, making it suitable for detailed mechanistic studies of its role in spore membrane assembly.

How does environmental stress influence SMA2 expression and function in V. polyspora?

Environmental stress likely plays a crucial role in regulating SMA2 expression and function in V. polyspora, similar to what has been observed with other proteins in this organism. V. polyspora has evolved sophisticated stress response mechanisms, exemplified by the GlyRS2 gene which remains essentially silent under normal growth conditions but becomes activated under specific stresses such as high pH, ethanol exposure, and most effectively, elevated temperature . By analogy, SMA2 expression may follow similar regulatory patterns, with specific stressors triggering its upregulation when its function becomes critical for cellular adaptation.

Temperature stress particularly warrants investigation, as GlyRS2 protein in V. polyspora shows increased stability under heat-shock conditions (37°C) compared to normal growth conditions (30°C) . SMA2 may similarly exhibit temperature-dependent stability profiles that influence its functional capacity during stress. This adaptation would be particularly relevant during sporulation, which is often triggered as a stress response in yeasts. The temperature-responsive nature of V. polyspora proteins suggests that SMA2 may incorporate structural elements that confer thermostability or temperature-dependent conformational changes that regulate its activity.

Oxidative stress and nutrient limitation are additional factors likely to modulate SMA2 expression, as these conditions typically precede sporulation in yeasts. To systematically characterize this relationship, researchers should implement a multi-factorial experimental design examining SMA2 expression and localization patterns across combinations of stressors, including:

  • Temperature gradients (25°C to 42°C)

  • pH variations (pH 4.0 to pH 8.0)

  • Osmotic stress conditions (varying NaCl concentrations)

  • Nutrient limitation scenarios (carbon, nitrogen, phosphorus)

  • Oxidative stress exposures (H₂O₂, menadione)

This comprehensive approach would reveal the specific stress conditions that regulate SMA2, providing insights into its physiological role during cellular adaptation and sporulation in V. polyspora.

What techniques can effectively measure SMA2 protein stability under varying experimental conditions?

Measuring SMA2 protein stability under varying experimental conditions requires a multi-technique approach that addresses both in vitro and in vivo aspects of protein behavior. Differential scanning fluorimetry (DSF) provides a high-throughput method for determining thermal stability by monitoring protein unfolding with increasing temperature using fluorescent dyes like SYPRO Orange that bind to exposed hydrophobic regions. This technique can generate melting curves for SMA2 under different buffer conditions, pH values, and in the presence of potential stabilizing agents.

For more detailed thermodynamic parameters, implement differential scanning calorimetry (DSC) which directly measures heat changes associated with protein unfolding without requiring fluorescent labels. This provides accurate determination of transition temperatures, enthalpy changes, and enables discrimination between multiple unfolding domains within SMA2. Circular dichroism (CD) spectroscopy complements these approaches by monitoring secondary structure changes during temperature increases or other perturbations, providing insight into which structural elements unfold first.

To assess SMA2 stability in its native membrane environment, develop a protease protection assay where membrane fractions containing SMA2 are exposed to controlled protease digestion under varying conditions. Increased protease susceptibility indicates destabilization or conformational changes. For in vivo stability assessment, pulse-chase experiments using metabolic labeling track SMA2 degradation rates under different conditions.

Given that V. polyspora proteins show distinct temperature-dependent behaviors—exemplified by GlyRS2 which remains stable at 37°C but becomes inactive above 40°C —implement a comparative activity assay measuring SMA2 function across a temperature range (25-45°C) to correlate stability with functional capacity. This comprehensive approach provides a nuanced understanding of SMA2 stability determinants, essential for optimizing experimental conditions and interpreting functional data.

How does SMA2 regulation compare to other stress-responsive proteins in V. polyspora?

SMA2 regulation likely shares mechanistic features with other stress-responsive proteins in V. polyspora while possessing unique characteristics related to its specialized function in spore membrane assembly. The GlyRS2 gene in V. polyspora provides a valuable comparative model, as it remains silent under normal growth conditions but becomes activated under specific stresses, particularly elevated temperature . This inducible expression pattern, controlled at the transcriptional level, may be mirrored in SMA2 regulation through shared stress-responsive promoter elements.

Regulatory AspectGlyRS2 (Known) Predicted SMA2 PatternExperimental Approach
Basal ExpressionSilent under normal conditionsLikely low during vegetative growthRT-qPCR, Western blot across growth phases
Stress InductionActivated by high pH, ethanol, high temperaturePotentially induced during nutrient limitation and early sporulationReporter constructs with SMA2 promoter
Protein StabilityMore stable at 37°C than 30°CMay show enhanced stability during sporulationPulse-chase analysis with temperature shifts
Subcellular LocalizationCytoplasmicMembrane-associated, possibly dynamic during sporulationFluorescence microscopy with GFP fusions
Functional Temperature RangeActive at 30-37°C, inactive above 40°CMay maintain function at higher temperatures to support stress-induced sporulationActivity assays across temperature gradient

Additionally, SMA2 may be subject to post-translational modifications that regulate its membrane association or interaction capabilities, a level of regulation potentially distinct from cytoplasmic proteins like GlyRS2. Phosphoproteomic analysis comparing vegetative cells with sporulating cells could reveal sporulation-specific modifications of SMA2. This comparative approach not only illuminates SMA2 regulation but also contributes to understanding the broader stress response network in V. polyspora.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.