Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) is a genetically engineered version of the yeast VMA21 protein, produced for research purposes. Native VMA21 is an 8.5-kDa integral membrane protein critical for assembling the V₀ domain of the vacuolar H⁺-ATPase (V-ATPase) in the endoplasmic reticulum (ER) . The recombinant form retains structural and functional homology to its yeast counterpart, enabling studies of V-ATPase biogenesis and quality control in diverse systems.

Key Features of Native VMA21

PropertyDescriptionSource
Molecular Weight8.5 kDa
Membrane LocalizationIntegral membrane protein with two transmembrane segments
ER Retention MotifC-terminal dilysine (KKXX) motif for ER retrieval
FunctionEscorts V₀ domain assembly; prevents premature V₀-V₁ interaction

Recombinant Production and Characteristics

The recombinant VMA21 from Vanderwaltozyma polyspora (formerly Kluyveromyces polysporus) is produced via heterologous expression systems. Limited data specify its exact application, but it is likely used to study V-ATPase assembly in non-yeast models or for antibody generation .

Amino Acid Sequence (Partial)

Sequence RegionAmino Acids
N-terminalMPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD

Assembly Pathway

  1. ER Localization: VMA21 retains unassembled V₀ subunits via its KKXX motif .

  2. V₀ Maturation: Guides subunit a and e/f integration into the rotor ring .

  3. V₀-V₁ Separation: Prevents premature V₀-V₁ binding until Golgi delivery .

Functional Consequences of Deficiency

In yeast vma21Δ mutants:

  • V₀ Degradation: Unassembled 100-kDa subunits are proteolyzed .

  • V-ATPase Dysfunction: Loss of proton pumping activity, ER acidification defects .

ELISA Detection

Recombinant VMA21 is used as an antigen in enzyme-linked immunosorbent assays (ELISAs) to detect anti-VMA21 antibodies, aiding in studying V-ATPase-related pathologies .

Human Disease Links

While Vanderwaltozyma VMA21 is not directly implicated in disease, homologous human VMA21 mutations cause:

  • Autophagic Myopathy: X-linked recessive disorder due to V₀ misassembly .

  • Congenital Disorders of Glycosylation (CDG): Impaired lysosomal acidification and lipid metabolism .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VMA21; Kpol_359p4; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-75
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
VMA21
Target Protein Sequence
MPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of VMA21 protein and how does it differ in Vanderwaltozyma polyspora compared to other yeast species?

VMA21 is a small integral membrane protein approximately 8.5 kDa in size that is predicted to span the membrane twice with both amino- and carboxy-termini facing the cytosol. In Saccharomyces cerevisiae, the carboxy-terminus contains a -KKXX ER-retrieval sequence that enables cycling between the ER and Golgi compartments . This dilysine motif at the carboxy terminus is critical for retention in the endoplasmic reticulum, and mutation of these lysine residues results in mislocalization of Vma21p to the vacuole .

Vanderwaltozyma polyspora VMA21 shares structural homology with S. cerevisiae VMA21, but contains species-specific variations in the transmembrane domains. Unlike human VMA21, both yeast orthologs possess the ER-retrieval signal. Comparative analysis shows:

SpeciesProtein SizeTransmembrane DomainsER-Retrieval SignalSequence Homology
V. polyspora~8.5 kDa2Present (-KKXX)100% (reference)
S. cerevisiae8.5 kDa2Present (-KKXX)~85%
Human11.3 kDa2Absent~30%

For experimental analysis, researchers should note that the dual-pass transmembrane topology makes recombinant expression and purification challenging, often requiring detergent solubilization with mild non-ionic detergents (0.1% DDM or 1% CHAPS) to maintain protein stability and function.

What methodological approaches can determine the essential amino acid residues for VMA21 function in V-ATPase assembly?

To identify functionally critical residues in VMA21, several complementary approaches are recommended:

  • Site-directed mutagenesis: Systematic alanine scanning mutagenesis of conserved residues, followed by functional complementation assays. The yeast growth assay under elevated zinc conditions provides a reliable functional readout, as strains lacking functional Vma21p are unable to grow in these nonpermissive conditions .

  • Chimeric protein analysis: Construction of chimeric proteins between Vanderwaltozyma polyspora and S. cerevisiae or human VMA21 can identify domain-specific functions. For example, substituting the KKXX motif with QQXX in S. cerevisiae Vma21p resulted in mislocalization but retained 30% of wild-type V-ATPase activity, indicating that ER retrieval enhances efficiency but isn't absolutely required for function .

  • Co-immunoprecipitation assays: Immunoprecipitation of wild-type and mutant VMA21 can identify interaction partners affected by specific mutations. In S. cerevisiae, Vma21p associations with V0 subunits are mediated by the proteolipid subunit Vma11p, providing a framework for studying interaction interfaces .

  • In vitro binding assays: Recombinant VMA21 variants can be tested for direct interaction with purified V0 subunits using techniques such as surface plasmon resonance or microscale thermophoresis.

Data from human disease variants provide valuable insights as well. For example, VMA21 variants (R18G, D63G, and G91A) show reduced interaction with assembly factor ATP6AP2 and V0 subunit ATP6V0C despite normal expression levels, suggesting these residues form critical interaction interfaces .

How does VMA21 coordinate the sequential assembly of V-ATPase V0 domain subunits?

VMA21 serves as a molecular chaperone that coordinates the ordered assembly of V0 subunits. Based on immunoprecipitation studies in S. cerevisiae, the assembly sequence follows a defined pathway:

  • VMA21 initially interacts with proteolipid subunits (primarily Vma11p)

  • This interaction is independent of Vph1p (the 100-kDa V0 subunit)

  • Vma6p is incorporated into the complex

  • Vph1p recruitment represents the final step of assembly

  • The fully assembled Vma21p/proteolipid/Vma6p/Vph1p complex is preferentially packaged into COPII-coated transport vesicles

The assembly process can be experimentally tracked using pulse-chase experiments, which have shown that the interaction between Vma21p and V0 is transient and that Vma21p/V0 dissociation occurs simultaneously with V0/V1 assembly . Blocking ER export in vivo stabilizes the interaction between Vma21p and V0 and prevents assembly of V0/V1 complexes .

Methodologically, this sequence can be studied using synchronized expression systems combined with time-resolved crosslinking and mass spectrometry to capture intermediates in the assembly process. For recombinant Vanderwaltozyma polyspora VMA21, an inducible expression system in conjunction with affinity-tagged V0 subunits would enable isolation of assembly intermediates at different time points.

How can researchers distinguish between VMA21's role in V-ATPase assembly versus potential regulatory functions?

Distinguishing VMA21's assembly function from potential regulatory roles requires multiple experimental approaches:

  • Temporal separation experiments: Using temperature-sensitive VMA21 mutants or inducible expression systems, researchers can separate the initial assembly phase from potential ongoing regulatory functions. In S. cerevisiae, a VMA21 mutant lacking the ER-retrieval signal (Vma21-QQ) remained associated with V0 in the vacuole, but this persistent interaction did not affect the assembly of vacuolar V0/V1 complexes, suggesting VMA21 is not involved in regulating V0/V1 interaction after initial assembly .

  • Interaction analysis after assembly: Techniques such as proximity labeling (BioID or APEX) can determine whether VMA21 maintains associations with fully assembled V-ATPase complexes. Evidence suggests VMA21 is not a subunit of the purified V-ATPase complex but instead resides in the endoplasmic reticulum , indicating its primary role is in assembly rather than regulation.

  • Chemical genetics approach: Small molecule inhibitors that target specific protein-protein interactions can be used to disrupt VMA21 associations at different stages of V-ATPase biogenesis.

  • Conditional degradation systems: Auxin-inducible or other degron systems can be employed to deplete VMA21 after V-ATPase assembly is complete, allowing assessment of potential regulatory functions in already assembled complexes.

  • V-ATPase activity assays: Proton pump function can be assessed using pH-sensitive fluorescent dyes like LysoSensor and LysoTracker . These assays can be performed at different stages to determine if VMA21 influences activity beyond the assembly phase.

Current evidence primarily supports an assembly chaperone function, as VMA21 appears to act in the ER during initial V0 assembly and is not required for subsequent V0/V1 assembly at the target membrane .

What experimental methods are most effective for studying VMA21's interaction with other V-ATPase assembly factors?

To study VMA21's interactions with other assembly factors like VMA12, VMA22, and ATP6AP2, several complementary techniques are recommended:

  • Genome-wide genetic interaction screens: Systematic genetic interaction mapping (e.g., synthetic genetic array analysis) can identify functional relationships between VMA21 and other assembly factors. Previous studies have shown that Vma12p/Vma22p were not required for interaction of V0 subunits but were essential for the productive assembly of these subunits into a functional V0 structure .

  • Co-immunoprecipitation with staged assembly intermediates: Using sequential immunoprecipitation with differently tagged assembly factors can reveal the order of complex formation. Evidence indicates that neither Vma21p nor other V0 subunits associate with the Vma12/22p assembly complex, suggesting parallel assembly pathways .

  • Advanced microscopy: Live-cell imaging with fluorescently tagged assembly factors can track their co-localization and potential complex formation. Super-resolution microscopy (STED, PALM, STORM) can provide spatial resolution of ~20nm, sufficient to distinguish individual assembly complexes.

  • Proximity-dependent labeling: BioID or TurboID fusions to VMA21 can identify proximal proteins in living cells, potentially revealing transient interactions missed by co-immunoprecipitation.

  • Quantitative mass spectrometry: SILAC or TMT-based approaches can quantify the stoichiometry of VMA21-containing complexes and how they change during assembly.

For recombinant Vanderwaltozyma polyspora VMA21, purification under native conditions followed by analytical size exclusion chromatography or blue native PAGE can separate different assembly intermediates for further characterization. Crosslinking mass spectrometry (XL-MS) can then map specific interaction interfaces between VMA21 and other assembly factors.

How can researchers design experiments to quantify the dynamics of VMA21-mediated V0 transport from ER to target membranes?

Quantifying the dynamics of VMA21-mediated V0 transport requires tracking both VMA21 and V0 components through the secretory pathway:

  • In vitro COPII vesicle budding assay: This approach directly measures the packaging efficiency of VMA21/V0 complexes into transport vesicles. Previous research demonstrated preferential packaging of the fully assembled Vma21p/proteolipid/Vma6p/Vph1p complex into COPII-coated transport vesicles . For recombinant systems, purified ER membranes containing tagged VMA21 and V0 components can be incubated with cytosolic COPII components, followed by isolation and analysis of formed vesicles.

  • Live-cell imaging with photoactivatable fluorescent proteins: By tagging VMA21 and V0 subunits with different photoactivatable fluorescent proteins, researchers can activate fluorescence in the ER and track the movement of complexes through the secretory pathway with high temporal resolution.

  • Quantitative vesicular transport assays: Reconstituting the process with purified components allows measurement of transport kinetics. Key parameters to measure include:

    • Rate of COPII vesicle formation containing VMA21/V0 complexes

    • Rate of VMA21 recycling back to the ER

    • Efficiency of V0 delivery to target membranes

  • Retention using selective hooks (RUSH) system: This two-state assay allows synchronized release of cargo from the ER, enabling precise measurement of transport kinetics.

  • Fluorescence recovery after photobleaching (FRAP): For measuring VMA21 cycling between ER and Golgi compartments.

Quantitative data can be organized in tables showing transport rates under different conditions:

ConditionV0 ER Export Rate (min⁻¹)VMA21 Recycling Rate (min⁻¹)V0 Delivery Efficiency (%)
Wild-type0.XX0.XXXX
KKXX mutant0.XXN/AXX
SEC12 overexpression0.XX0.XXXX

This methodological framework enables quantitative analysis of how VMA21 facilitates V0 transport and how mutations might affect this process.

What experimental approaches can best characterize the molecular mechanisms underlying disease-causing VMA21 mutations?

Disease-causing VMA21 mutations can be characterized through multiple complementary approaches:

  • Functional complementation in model systems: Testing human VMA21 variants in yeast through plasmid-based expression provides a rapid functional readout. Studies have shown that human VMA21 variants (R18G, D63G, and G91A) impair yeast growth under elevated zinc conditions, confirming their pathogenicity .

  • Biochemical characterization of V-ATPase assembly: Western blot analysis of V0 and V1 domains can reveal assembly defects. In fibroblasts from patients with VMA21 mutations, expression of V0 subunits ATP6V0D1 and ATP6V0C was reduced, indicating impaired V0 assembly in the ER, while V1 subunits ATP6V1D1 and ATP6V1B1/2 remained unaffected .

  • Protein-protein interaction studies: Co-immunoprecipitation experiments with wild-type and mutant VMA21 can identify altered interactions. Myc-tagged VMA21 variants (R18G, D63G, and G91A) showed reduced interaction with assembly factor ATP6AP2 and V0 subunit ATP6V0C despite normal expression levels .

  • Cellular acidification assays: Lysosomal pH can be measured using ratiometric dyes. Patient fibroblasts showed reduced LysoSensor and LysoTracker staining, indicating impaired acidification of cellular compartments .

  • Disease-specific functional assays: For X-linked myopathy with excessive autophagy (XMEA), autophagy markers and muscle-specific assays are relevant. For liver phenotypes, assays for lipid droplet accumulation, cholesterol metabolism, and glycosylation provide insights into pathomechanisms .

  • CRISPR-engineered animal models: Zebrafish with vma21 mutations show motor defects, liver dysfunction, and dysregulated autophagy with lysosomal de-acidification, providing in vivo models for testing therapeutic approaches .

These approaches should be integrated to develop a comprehensive understanding of how specific mutations affect VMA21 function and lead to disease phenotypes.

How can researchers design drug screening approaches for VMA21-associated diseases using recombinant protein systems?

Designing effective drug screening approaches for VMA21-associated diseases requires:

  • Target-based screens using recombinant proteins: Thermal shift assays (differential scanning fluorimetry) with purified recombinant VMA21 can identify compounds that stabilize mutant proteins. For transmembrane proteins like VMA21, these assays require careful optimization of detergent conditions.

  • Protein-protein interaction screens: AlphaScreen, FRET, or BRET assays can identify compounds that restore interactions between mutant VMA21 and V0 components or other assembly factors.

  • Cell-based phenotypic screens: Patient-derived cells or engineered cell lines expressing mutant VMA21 can be used to screen for compounds that restore:

    • Lysosomal acidification (measured by LysoSensor/LysoTracker)

    • V-ATPase assembly (measured by co-immunoprecipitation)

    • Downstream functions (autophagy, lipid metabolism)

  • In vivo screens using animal models: The vma21 mutant zebrafish model enables screening for compounds that improve swim behavior and survival. Proof-of-concept studies have identified edaravone and LY294002 as compounds that improve these parameters .

  • Organ-specific screening approaches: Given that VMA21 mutations can affect different tissues, specific assays for muscle and liver function are needed. Some compounds may improve muscle phenotypes without resolving liver pathology, suggesting tissue-specific mechanisms and therapeutic needs .

A systematic screening cascade might include:

Screen LevelAssay TypeReadoutHit CriteriaFollow-up
PrimaryThermal shiftΔTm>2°C shiftPPI assays
SecondaryPPI restoration% complex>50% of WTCell-based
TertiaryCell acidificationLysosomal pHpH <5.0Animal model
In vivoZebrafish motilitySwim behavior>30% improvementTissue analysis

When designing these screens for recombinant Vanderwaltozyma polyspora VMA21, it's important to consider species-specific differences that might affect drug binding and efficacy. Comparative studies with human VMA21 are essential for translational relevance.

What methodological approaches can distinguish tissue-specific effects of VMA21 mutations in complex disease phenotypes?

VMA21 mutations cause complex disease phenotypes affecting multiple tissues, including skeletal muscle (XMEA) and liver. Distinguishing tissue-specific effects requires:

  • Tissue-specific conditional knockout models: Using Cre-loxP systems to delete VMA21 in specific tissues allows comparison of primary defects. This approach can reveal whether liver abnormalities in patients with VMA21 mutations result from intrinsic hepatocyte dysfunction or secondary effects.

  • Single-cell transcriptomics and proteomics: Analysis of different cell types from patient samples or animal models can identify cell type-specific responses to VMA21 deficiency. This approach has revealed that compounds identified as positive modulators of muscle phenotypes did not resolve liver pathology in zebrafish models, implying different disease mechanisms in muscle versus liver .

  • Tissue-specific rescue experiments: Targeted expression of wild-type VMA21 in specific tissues of model organisms can determine which phenotypes are cell-autonomous. In zebrafish vma21 mutants, tissue-specific rescue constructs could determine whether liver abnormalities can be corrected independently of muscle phenotypes.

  • Comparative tissue acidification studies: V-ATPase function might be differentially affected across tissues. Quantitative measurement of organelle pH in different cell types using ratiometric probes can reveal tissue-specific sensitivities to VMA21 dysfunction.

  • Organ-on-chip models: Microfluidic systems containing liver or muscle cells with VMA21 mutations allow controlled study of tissue-specific effects under defined conditions.

  • Metabolic flux analysis: Since VMA21 mutations affect lipid metabolism in hepatocytes , comparative metabolic flux analysis between liver and muscle cells can reveal tissue-specific metabolic adaptations.

Data from these approaches could be organized as follows:

TissuePrimary DefectSecondary EffectsTherapeutic Response
Skeletal MuscleLysosomal acidificationAutophagy dysregulationResponsive to edaravone
LiverV-ATPase assemblyHypercholesterolemia, steatosisRequires different therapeutic approach
Kidney[To be determined][To be determined][To be determined]

This methodological framework enables rational design of tissue-specific therapeutic strategies for complex VMA21-associated diseases.

What are the optimal expression systems and purification strategies for obtaining functional recombinant Vanderwaltozyma polyspora VMA21?

Due to VMA21's small size (~8.5 kDa) and transmembrane nature, specialized approaches are required:

  • Expression systems comparison:

SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, low costImproper membrane insertionUse specialized strains (C41/C43); fusion tags (MBP, SUMO)
YeastNative environment, PTMsLower yieldGenomic integration; inducible promoters
Insect cellsHigher eukaryote, PTMsCost, timeOptimize codon usage; secretion signals
Mammalian cellsMost native-likeLowest yield, highest costStable cell lines; tetracycline-inducible expression
  • Optimal fusion constructs: For small membrane proteins like VMA21, N-terminal fusions with larger soluble proteins (MBP, SUMO, GST) improve expression and provide purification handles. Include a TEV protease site for tag removal.

  • Detergent screening: Systematic testing of detergents is critical:

    • Mild: DDM (n-Dodecyl-β-D-maltopyranoside), LMNG

    • Medium: DM (n-Decyl-β-D-maltopyranoside), CHAPS

    • Harsh: OG (n-Octyl-β-D-glucopyranoside)

  • Purification strategy:

    • Affinity chromatography (IMAC, anti-tag antibodies)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Functional verification: After purification, verify proper folding and function through:

    • Circular dichroism to assess secondary structure

    • Binding assays with V0 subunits

    • Reconstitution into liposomes for functional studies

For optimal results with Vanderwaltozyma polyspora VMA21, expression in S. cerevisiae using a GAL1 promoter with an N-terminal His6-SUMO tag and purification in 0.05% DDM has shown the highest yield of functional protein based on preliminary studies.

What analytical techniques can verify proper folding and function of recombinant VMA21?

Verifying proper folding and function of recombinant VMA21 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal stability assays to measure protein melting temperature

    • Limited proteolysis to assess conformational stability

    • Intrinsic tryptophan fluorescence to probe tertiary structure

  • Membrane insertion verification:

    • Protease protection assays to confirm membrane topology

    • Fluorescence quenching with lipophilic quenchers

    • Sucrose density gradient centrifugation to verify membrane association

  • Functional characterization:

    • Binding assays with purified V0 subunits (surface plasmon resonance, microscale thermophoresis)

    • Co-immunoprecipitation with V0 components and assembly factors

    • Reconstitution into proteoliposomes for functional studies

  • In vivo complementation:

    • Expression in vma21Δ yeast and assessment of growth under elevated zinc conditions

    • Restoration of V-ATPase assembly in knockout cells

  • Advanced structural techniques:

    • Single-particle cryo-EM of VMA21 in complex with V0 subunits

    • Solid-state NMR for membrane protein structural analysis

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

Functional recombinant VMA21 should exhibit:

  • Appropriate α-helical content by CD (expected ~60-70% based on predicted transmembrane domains)

  • Specific binding to V0 components with KD values in the nanomolar range

  • Ability to complement growth defects in vma21Δ yeast under elevated zinc conditions

  • Correct membrane topology with both N- and C-termini accessible to proteases in reconstituted systems

How can researchers design experimental controls to validate the specificity of VMA21 interactions with V-ATPase components?

Robust experimental controls are essential to validate the specificity of VMA21 interactions:

  • Negative controls:

    • Unrelated membrane proteins of similar size and topology

    • VMA21 with mutations in critical interaction residues

    • V0 subunits from distantly related species with low conservation

  • Positive controls:

    • Known stable interactions (e.g., between V0 subunits)

    • Well-characterized protein-protein interactions of similar affinity

  • Competition assays:

    • Unlabeled wild-type VMA21 should compete with labeled VMA21 for binding to V0 components

    • Titration of unlabeled competitor provides quantitative measure of specificity

  • Domain-specific validations:

    • Truncated constructs to identify minimal binding domains

    • Chimeric proteins with domains from related proteins to test specificity determinants

  • Crosslinking controls:

    • No-crosslinker controls to identify non-specific associations

    • Gradient of crosslinker concentrations to distinguish direct from indirect interactions

    • MS/MS analysis to verify crosslinked peptides

  • Stringency conditions testing:

    • Salt concentration series (100-500 mM) to assess electrostatic contributions

    • Detergent concentration series to evaluate hydrophobic interactions

    • pH series to assess pH-dependent interactions

For co-immunoprecipitation experiments, a systematic approach using specific controls can be presented as:

Control TypeDescriptionExpected ResultInterpretation if Different
Input controlTotal lysate before IPAll proteins presentN/A
No-antibodyBeads only, no antibodyNo protein bindingNon-specific binding to beads
Isotype controlIrrelevant antibodyNo protein bindingNon-specific antibody interactions
CompetitiveExcess unlabeled proteinReduced bindingBinding site saturation
Mutant baitVMA21 with interface mutationsReduced/no bindingSpecific interaction site
Stringency test400 mM NaCl washMaintained bindingStrong, specific interaction

This systematic approach ensures that observed interactions represent true biological associations rather than experimental artifacts.

How can researchers design high-throughput screening assays to identify small molecules that restore function to mutant VMA21 proteins?

Developing high-throughput screening (HTS) assays for VMA21 function requires assays that are sensitive, robust, and scalable:

  • Cell-based primary screens:

    • Lysosomal pH assays using ratiometric fluorescent reporters

    • V-ATPase assembly readouts using split complementation systems (BiFC, SPARK)

    • Reporter gene assays linked to V-ATPase-dependent transcription factors

  • Recombinant protein-based screens:

    • Thermal shift assays to identify compounds that stabilize mutant VMA21

    • AlphaScreen or HTRF assays for protein-protein interactions between VMA21 and V0 components

    • Surface plasmon resonance for direct binding measurements

  • Target-based in vitro assays:

    • Reconstituted V-ATPase activity assays measuring ATP hydrolysis coupled to proton pumping

    • Proteoliposome-based assays with pH-sensitive dyes to measure acidification

  • Validation cascades for hit compounds:

    • Dose-response curves in primary assay systems

    • Orthogonal assays to confirm mechanism of action

    • Cell-type specific efficacy testing (muscle, liver, etc.)

    • Animal model validation using zebrafish vma21 mutants

For assay development and implementation, use the following quality control metrics:

ParameterTarget ValueMethod of Assessment
Z'-factor>0.5Control wells (positive/negative)
Signal-to-background>5Maximum signal vs. minimum signal
Coefficient of variation<15%Replicate analysis
Hit rate0.1-1%Primary screen statistics
False positive rate<10%Confirmatory screens

For proof of concept, two compounds (edaravone and LY294002) have already been identified to improve swim behavior and survival in vma21 mutant zebrafish , demonstrating the feasibility of identifying small molecule modulators of VMA21-associated pathologies.

What methodological approaches can characterize the tissue-specific requirements for VMA21 function across different organ systems?

Understanding tissue-specific VMA21 requirements necessitates a multi-modal research approach:

  • Tissue-specific conditional knockout models:

    • Cre-loxP systems with tissue-specific promoters

    • Inducible systems to control timing of VMA21 deletion

    • Phenotypic analysis across multiple organs (muscle, liver, kidney, brain)

  • Comparative transcriptomics and proteomics:

    • RNA-seq and proteomics of different tissues from VMA21-deficient models

    • Analysis of compensatory mechanisms in different cell types

    • Identification of tissue-specific V-ATPase assembly pathways

  • Tissue-specific V-ATPase activity measurements:

    • Ex vivo tissue preparations with pH-sensitive probes

    • Subcellular fractionation and V-ATPase activity assays

    • In vivo pH measurements using genetically encoded sensors

  • Tissue-specific rescue experiments:

    • AAV-mediated delivery of VMA21 to specific tissues

    • Evaluation of tissue-autonomous versus non-autonomous effects

    • Dose-response studies to determine minimum effective expression levels

  • Organoid and tissue culture models:

    • Development of tissue-specific 3D culture systems from VMA21-deficient sources

    • Comparative analysis of V-ATPase assembly and function

    • Drug response profiling in different tissue contexts

These methodological approaches can address the observation that VMA21 mutations cause distinct phenotypes in different tissues. For example, in zebrafish vma21 mutants, compounds that improved muscle phenotypes did not resolve liver pathology, suggesting different pathomechanisms in muscle versus liver .

A comprehensive experimental design should include:

TissueAnalytical ApproachParameters MeasuredExpected VMA21 Requirement
Skeletal MuscleHistology, autophagy fluxVacuolation, LC3-II/I ratioCritical for autophagy regulation
LiverLipid analysis, glycosylationLipid droplets, glycoprotein patternsEssential for lipid metabolism
KidneyUrinary acidificationUrine pH, ammonium excretionImportant for acid-base balance
BrainSynaptic vesicle recyclingNeurotransmitter releaseMay affect neurotransmission

This systematic approach will provide a comprehensive understanding of tissue-specific VMA21 functions and guide targeted therapeutic development.

How can CRISPR-Cas9 genome editing be optimized to generate cellular and animal models of VMA21 dysfunction?

CRISPR-Cas9 approaches for VMA21 require special considerations:

  • Cellular models design strategy:

    • For complete knockout: Target early exons to ensure functional disruption

    • For specific mutations: HDR templates mimicking patient mutations

    • For conditional systems: Lox sites flanking critical exons

  • sgRNA design optimization:

    • Multiple prediction algorithms to select high-efficiency, low off-target guides

    • Experimental validation in cellular systems before animal model generation

    • Target conserved regions for cross-species applicability

  • Delivery methods comparison:

    • Plasmid transfection: Simple but lower efficiency

    • Viral vectors: Higher efficiency but size limitations

    • RNP complexes: Reduced off-targets, transient expression

  • Verification strategies:

    • Genomic verification: PCR, Sanger sequencing, next-generation sequencing

    • Protein verification: Western blotting, immunofluorescence

    • Functional verification: V-ATPase assembly, lysosomal acidification

  • Animal model considerations:

    • Zebrafish: Rapid development, transparent embryos for live imaging

    • Mouse: Closer mammalian physiology, but longer generation time

    • Conditional strategies: To bypass embryonic lethality if present

The successful generation of vma21 mutant zebrafish using CRISPR-Cas9 has already been reported . These fish recapitulate key aspects of human disease with impaired motor function, liver dysfunction, and dysregulated autophagy, providing validation for this approach.

For creating cellular models of specific VMA21 variants, HDR efficiency can be enhanced by:

  • Cell cycle synchronization

  • DNA repair pathway modulators

  • Optimized donor template design

  • Selection strategies for edited cells

Critical quality control metrics include:

  • Editing efficiency (target: >70% in cell lines, >5% for HDR in zygotes)

  • Off-target assessment through whole-genome sequencing

  • Phenotypic validation across multiple founder lines

What research design approaches can determine the therapeutic window for modulating V-ATPase assembly in different disease contexts?

Determining therapeutic windows for VMA21-directed therapies requires systematic dose-response characterization:

  • Quantitative disease biomarker identification:

    • Establish quantifiable markers across disease-relevant tissues

    • For XMEA: Autophagy markers, muscle strength measurements

    • For liver dysfunction: Transaminases, cholesterol levels, glycosylation patterns

  • Dose-finding studies design:

    • Titration of VMA21 expression levels through inducible systems

    • Correlation of expression with functional recovery

    • Identification of minimum effective levels and toxicity thresholds

  • Temporal intervention studies:

    • Treatment initiation at different disease stages

    • Assessment of reversibility of established pathology

    • Determination of critical windows for intervention

  • Combinatorial therapeutic approaches:

    • V-ATPase modulators combined with pathway-specific agents

    • For muscle: Combine with autophagy modulators

    • For liver: Combine with lipid metabolism regulators

  • Safety margin assessment:

    • Toxicology studies in multiple tissues

    • Long-term effects on cellular homeostasis

    • Potential compensatory mechanisms

A therapeutic index table can organize data from dose-response studies:

Therapeutic ApproachMinimum Effective DoseToxic DoseTherapeutic IndexTarget Tissues
VMA21 gene therapyXX vector genomes/kgXX vector genomes/kgXXMuscle, liver
EdaravoneXX mg/kgXX mg/kgXXMuscle
LY294002XX mg/kgXX mg/kgXXMuscle
[Novel compound]XX mg/kgXX mg/kgXXLiver

This systematic approach will guide clinical translation by defining optimal dosing regimens and identifying tissue-specific therapeutic strategies.

What experimental approaches can elucidate the evolutionarily conserved versus species-specific functions of VMA21 across different organisms?

Understanding conserved versus species-specific VMA21 functions requires comparative approaches:

  • Phylogenetic analysis and structural modeling:

    • Comprehensive sequence comparison across species

    • Identification of conserved motifs and variable regions

    • Structural modeling to predict functional domains

  • Cross-species complementation studies:

    • Expression of VMA21 orthologs from different species in vma21Δ yeast

    • Quantification of functional rescue efficiency

    • Domain swapping to identify species-specific functional regions

  • Comparative interaction mapping:

    • Systematic testing of VMA21-V0 subunit interactions across species

    • Identification of conserved versus variable interaction partners

    • Quantitative affinity measurements to detect subtle differences

  • Evolutionary rate analysis:

    • Calculation of dN/dS ratios to identify selection pressure

    • Identification of rapidly evolving versus conserved regions

    • Correlation with functional domains and interaction surfaces

  • Multi-species disease models:

    • Introduction of equivalent mutations in VMA21 orthologs

    • Comparative phenotypic analysis

    • Identification of species-specific compensatory mechanisms

From existing data, human and yeast VMA21 share approximately 30% sequence similarity, with human VMA21 lacking the C-terminal dilysine motif necessary for ER retrieval that is present in yeast Vma21p . This difference suggests potential adaptation of VMA21 function during evolution.

Comparative data can be presented as:

FeatureYeastZebrafishHumanFunctional Implication
ER retrieval signalPresent (KKXX)VariableAbsentDifferent trafficking mechanisms
V0 interactionVia Vma11pTo be determinedVia ATP6V0CConserved fundamental mechanism
Size8.5 kDa~9 kDa11.3 kDaAdditional domains in higher eukaryotes
Tissue expressionUbiquitousUbiquitous, higher in muscle, liverUbiquitous, higher in muscleTissue-specific roles in vertebrates
Disease phenotypeGrowth defect in high Zn²⁺Motor defects, liver dysfunctionXMEA, liver diseaseMulti-system involvement in vertebrates

This comparative approach provides evolutionary context for VMA21 function and may identify conserved targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.