Recombinant Varecia variegata rubra Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Varecia variegata rubra (Red ruffed lemur) (Varecia rubra)
Target Names
Target Protein Sequence
MPVQGSLRSLVGAVNSTPTASPHLRPATNQTEPQCLEVSVPVGLFLCLGLVSLVENTLVV AVIAKNRNLHSPMYCFICCLALSDLLVSVSNVLKTAVLLLLEAGALAAQATVVQQLGNVI NMLICSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLARARRAIAAVWVASILSSILFF TYYDRTAALLCLVVFFLAMLVLMAVLYVHMLTQACQHAQGIARLHKRQHPVQQGWGLKGA ATLAVLLGVFFLCWGPLFLHLTLIAVCPQHPTCNCIVKNFKLFLALIICNAIVDPLIYAF RSQELRKTLKEVLLFSW
Uniprot No.

Target Background

Function
This receptor is responsible for binding to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor plays a critical role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing functional Varecia variegata rubra MC1R?

While E. coli is commonly used for expressing recombinant Varecia variegata rubra MC1R with His-tag purification (achieving >90% purity via SDS-PAGE), this bacterial system may not provide optimal post-translational modifications for functional studies. For functional analyses, mammalian expression systems (HEK293 or CHO cells) are preferred as they better replicate native glycosylation patterns and membrane insertion. Insect cell systems (Sf9 or Hi5) represent an intermediate option, offering some post-translational modifications with higher yield than mammalian systems .

Comparative expression yields:

Expression SystemRelative YieldPost-translational ModificationsFunctional Activity
E. coliHighMinimalLimited
Insect cellsModerate-HighPartialModerate
Mammalian cellsLow-ModerateExtensiveHigh

What optimal storage and handling protocols ensure MC1R stability?

For maximum stability of recombinant Varecia variegata rubra MC1R:

  • Store lyophilized protein at -20°C/-80°C (shelf life approximately 12 months)

  • For reconstituted protein, store at -20°C/-80°C with 50% glycerol (shelf life approximately 6 months)

  • Avoid repeated freeze-thaw cycles (create working aliquots stored at 4°C for up to one week)

  • Reconstitute to 0.1-1.0 mg/mL in deionized sterile water

  • For buffer exchange or dilution, use Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

  • Briefly centrifuge vials before opening to bring contents to the bottom

How can researchers effectively validate functional activity of recombinant MC1R?

Functional validation of recombinant Varecia variegata rubra MC1R requires multiple complementary approaches:

  • Ligand binding assays:

    • Competitive binding using radiolabeled α-MSH or NDP-MSH

    • FRET-based binding assays with fluorescently-labeled melanocortin peptides

  • Signaling pathway activation:

    • cAMP accumulation assays (MC1R activates adenylyl cyclase)

    • CREB phosphorylation analysis via Western blot

    • Calcium flux measurements in transfected cells

  • Phenotypic assays:

    • Melanin production in melanocytes expressing recombinant MC1R

    • ERK1/2 phosphorylation in response to α-MSH stimulation

Each assay should include appropriate positive controls (human MC1R) and negative controls (mock-transfected cells) .

What are the key considerations when designing experiments to investigate MC1R expression patterns in tissue samples?

When investigating MC1R expression patterns in tissue samples, researchers should consider:

  • Antibody selection and validation:

    • Validate antibody specificity using positive controls (melanoma cell lines with known MC1R expression) and negative controls (tissues known to lack MC1R)

    • Test antibodies against recombinant MC1R protein

    • Consider cross-reactivity with other melanocortin receptors (MC2R-MC5R)

  • Detection methodologies:

    • Quantitative immunofluorescence provides superior sensitivity and quantitation compared to standard IHC

    • Use multiplex immunofluorescence to simultaneously detect MC1R and cell-type specific markers

  • Image analysis and quantification:

    • Apply automated quantitative analysis methods

    • Use continuous scoring rather than categorical (positive/negative) assessment

    • Normalize expression to appropriate reference proteins

  • Sample preparation:

    • Optimize fixation protocols (overfixation can mask MC1R epitopes)

    • Consider antigen retrieval methods specific for membrane proteins

    • Use tissue microarrays for high-throughput analysis

How do various MC1R variant analysis methods compare in accuracy and throughput?

Comparison of MC1R variant analysis methods shows significant trade-offs:

MethodThroughputCostError RateAdvantagesLimitations
Sanger sequencingLowModerate<0.1%Gold standard accuracyLabor intensive, low throughput
High-throughput sequencingHighLow per sample0.4-0.5%Comprehensive variant detectionRequires specialized bioinformatics
Custom genotyping arraysVery highVery low per sample<1%Cost-effective for known variantsCannot detect novel variants
GATK pipelineHighLow~0.44%Standardized approachMay introduce systematic errors at specific loci

For comprehensive MC1R variant detection, high-throughput sequencing with proper quality control is recommended. When analyzing sequencing data, researchers should implement stringent quality filters, including minimum read depth (>7 reads), balanced allele representation, and manual inspection of discordant calls. Deviation from Hardy-Weinberg equilibrium should be assessed for each variant to identify potential genotyping errors .

How does MC1R expression correlate with melanoma progression and what are the implications for targeted therapy?

MC1R expression shows a significant stepwise increase during melanoma progression:

What methodological approaches can resolve contradictory findings in MC1R functional studies?

To resolve contradictory findings in MC1R functional studies, researchers should implement:

  • Standardized expression systems:

    • Use identical expression vectors and host cells across studies

    • Quantify receptor expression levels using standardized techniques

    • Verify correct membrane localization and glycosylation

  • Functional characterization controls:

    • Include reference MC1R variants with well-established phenotypes

    • Use concentration-response curves rather than single-dose experiments

    • Measure multiple downstream signaling pathways simultaneously

  • Statistical considerations:

    • Perform power calculations to ensure adequate sample sizes

    • Use multivariate analysis to adjust for confounding variables

    • Consider genetic background effects in model systems

  • Replication and validation:

    • Validate findings in multiple cell types

    • Confirm in vitro findings in ex vivo tissue samples or in vivo models

    • Compare recombinant systems with native expression

These approaches help distinguish true biological variations from methodological artifacts when studying MC1R function .

How can researchers accurately assess the impact of MC1R variants on non-melanoma skin cancer risk?

For accurate assessment of MC1R variants on non-melanoma skin cancer risk:

  • Study design considerations:

    • Case-control studies with adequate power (minimum 200 cases, 200 controls)

    • Prospective cohort studies to establish temporal relationships

    • Adjustment for confounding factors:

      • Age

      • Sex

      • Intermittent and chronic sun exposure

      • Lifetime and childhood sunburns

      • Smoking status

  • Statistical analysis methodology:

    • Calculate odds ratios (OR) with 95% confidence intervals using logistic regression

    • Test for Hardy-Weinberg equilibrium deviation

    • Perform sensitivity analyses and meta-regression

    • Use multivariate approaches to account for correlation between ORs

  • Genotyping quality control:

    • Verify genotyping accuracy (>95%)

    • Confirm rare variants with alternative methods

    • Handle missing data using multiple imputation models for variables with <5% missing values

What are the current challenges in translating MC1R research from animal models to human applications?

Major challenges in translating MC1R research include:

  • Species-specific differences:

    • Sequence variations between Varecia variegata rubra MC1R and human MC1R affect ligand binding

    • Signaling pathway differences between species alter downstream responses

    • Melanocyte distribution and function vary across species

  • Model system limitations:

    • Cell culture models lack tissue microenvironment complexity

    • Animal models may not recapitulate human melanoma progression

    • Transgenic models expressing lemur MC1R may show unexpected phenotypes

  • Methodological barriers:

    • Standardization of expression and purification protocols

    • Development of cross-species reactive tools (antibodies, ligands)

    • Quantitative comparison of functional parameters

  • Clinical application challenges:

    • Determining efficacy thresholds for MC1R-targeted therapies

    • Understanding MC1R biodistribution in humans

    • Optimizing dosing and delivery of MC1R-targeted compounds

Beyond melanoma, what other disease contexts show promising applications for MC1R research?

MC1R research shows emerging potential in multiple disease contexts:

  • Parkinson's disease:

    • Loss-of-function MC1R variants correlate with increased Parkinson's disease risk

    • MC1R-variant mice show increased susceptibility to dopaminergic toxins

    • MC1R may have neuroprotective functions independent of pigmentation

  • Pain sensitivity modulation:

    • MC1R variants affect pain thresholds through altered proopiomelanocortin processing

    • Balance between beta-endorphin and melanocyte stimulating hormone levels affects pain response

    • MC1R dysfunction favors opioid receptor activation, increasing pain threshold

  • Endometriosis:

    • MC1R variants show association with endometriosis risk

    • Potential mechanisms involve inflammatory modulation and cell proliferation

  • Prostate cancer:

    • Interestingly, some MC1R variants correlate with decreased prostate cancer risk

    • Mechanism may involve altered androgen signaling or inflammatory processes

What novel analytical approaches are improving MC1R variant detection and functional characterization?

Cutting-edge approaches for MC1R analysis include:

  • Advanced sequencing technologies:

    • Long-read sequencing enables phasing of MC1R variants

    • Single-cell sequencing reveals expression heterogeneity

    • Targeted nanopore sequencing provides rapid variant identification

  • Computational methods:

    • Machine learning algorithms predict functional impacts of variants

    • Molecular dynamics simulations model structural consequences

    • Systems biology approaches integrate MC1R into signaling networks

  • Functional genomics:

    • CRISPR-based saturation mutagenesis screens

    • Massively parallel reporter assays for regulatory variants

    • Proteomics analysis of MC1R interaction networks

  • Imaging techniques:

    • Super-resolution microscopy for MC1R localization

    • Intravital imaging to track MC1R trafficking

    • PET imaging with MC1R-targeted radiotracers for in vivo characterization

How can researchers optimize recombinant MC1R for therapeutic and diagnostic applications?

Optimization strategies for recombinant MC1R applications:

  • Protein engineering approaches:

    • Stability enhancement through disulfide engineering

    • Solubility improvement via hydrophilic surface mutations

    • Expression optimization through codon optimization

    • Affinity maturation for improved ligand binding

  • Theranostic development:

    • Dual-function constructs with imaging and therapeutic capabilities

    • Site-specific conjugation methods for consistent drug loading

    • Modular designs allowing interchangeable payloads

  • Delivery system integration:

    • Incorporation into nanoparticle formulations

    • Cell membrane-derived vesicles containing MC1R

    • Bioconjugation with targeting moieties

  • Quality control considerations:

    • Development of functional potency assays

    • Stability-indicating analytical methods

    • Reference standards for batch-to-batch consistency

What are common pitfalls in recombinant MC1R purification and how can they be addressed?

Common purification challenges and solutions include:

ChallengeCauseSolution
Low yieldPoor expression or inefficient extractionOptimize expression conditions (temperature, induction time); Try different detergents for membrane extraction
AggregationHydrophobic transmembrane domainsAdd stabilizing agents (glycerol, specific lipids); Use mild detergents during purification
Proteolytic degradationEndogenous proteasesAdd protease inhibitors throughout purification; Perform purification at 4°C
Co-purifying contaminantsNon-specific binding to affinity resinIncrease imidazole in wash buffer; Add secondary purification step (ion exchange, size exclusion)
Loss of activityDenaturation during purificationMaintain physiological pH; Include ligands during purification to stabilize active conformation

Additionally, impurities can be minimized by using gradient elution from affinity columns and validating purity through both SDS-PAGE and analytical size exclusion chromatography .

How should researchers address conflicting data in MC1R expression studies across different tissue types?

When facing conflicting MC1R expression data:

  • Technical validation:

    • Confirm antibody specificity with peptide competition assays

    • Verify results with orthogonal methods (qPCR, Western blot, mass spectrometry)

    • Rule out post-translational modifications masking epitopes

  • Biological factors:

    • Consider tissue-specific MC1R splicing variants

    • Evaluate heterogeneity within tissue samples

    • Assess impact of tumor microenvironment on expression

  • Methodological standardization:

    • Use consistent tissue processing protocols

    • Establish quantitative scoring methods with internal controls

    • Apply digital pathology algorithms for objective assessment

  • Integrated analysis:

    • Correlate protein expression with gene expression data

    • Perform single-cell analysis to identify expressing cell populations

    • Consider spatial context through multiplexed imaging

What quality control metrics should be applied to ensure reliability of MC1R variant analysis?

Essential quality control metrics for MC1R variant analysis:

  • Sequencing quality parameters:

    • Minimum read depth >10x for reliable variant calling

    • Balanced allele fractions (40-60% for heterozygous calls)

    • Phred quality scores >30 for base calls

  • Variant calling validation:

    • Hardy-Weinberg equilibrium testing (p>0.05)

    • Cross-platform validation of rare variants

    • Sanger confirmation of high-impact variants

  • Sample quality assessment:

    • DNA quality metrics (A260/A280 ratio, fragment size)

    • Sample contamination screening

    • Sex-chromosome consistency checks

  • Data analysis reliability:

    • Sensitivity analysis with varying calling parameters

    • Concordance rates between technical replicates (>99%)

    • Comparison with reference datasets (1000 Genomes)

Implementation of these quality metrics reduced discordance rates from 0.44% to <0.1% in comparative studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.