Recombinant Varecia variegata variegata Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Biological Significance of MC1R

MC1R is a key regulator of melanin synthesis, determining the ratio of red/yellow pheomelanin to brown/black eumelanin. Variants in MC1R are linked to coat color variation in mammals, UV sensitivity, and melanoma risk . In primates, MC1R evolution is under purifying selection, reflecting its conserved role in survival and adaptation .

Functional Insights

  • Ligand Binding: MC1R activation by α-MSH increases cAMP, upregulating MITF (microphthalmia-associated transcription factor) to drive melanogenesis .

  • Dimerization: Constitutive homo-dimerization via disulfide bonds (C35, C267, C273, C275) is essential for receptor function .

  • Evolutionary Conservation: Purifying selection in Lorisidae primates (MC1R ω = 0.0912) underscores its non-redundant role in survival .

Research Applications

  • Mechanistic Studies: Recombinant MC1R enables investigation of UV-induced DNA repair, apoptosis, and melanoma risk .

  • Comparative Genomics: Used to study coat color evolution in primates and adaptive melanin responses .

  • Therapeutic Development: Insights into MC1R signaling may inform treatments for pigmentation disorders or skin cancer .

Comparative Analysis with Other Species

FeatureVarecia variegata variegata MC1RHuman MC1R
Amino Acid Length317 residues 317 residues
Key PolymorphismsNot reportedR151C, R160W linked to red hair
Functional StudiesRole in primate coat color evolution Melanoma risk modulation

Limitations and Future Directions

  • Current studies focus on in vitro systems; in vivo functional validation in lemurs is lacking .

  • Structural resolution (e.g., cryo-EM) is needed to map ligand-binding interfaces .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is dependent on various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Varecia variegata variegata (Black and white ruffed lemur)
Target Names
Target Protein Sequence
MPVQGSLRSLVGAVNSTPTASPHLRPATNQTEPQCLEVSVPVGLFLCLGLVSLVENTLVV AVIAKNRNLHSPMYCFICCLALSDLLVSVSNVLKTAVLLLLEAGALAAQATVVQQLGNVI NMLICSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLARARRAIAAVWVASILSSILFF TYYDRTAALLCLVVFFLAMLVLMAVLYVHMLTQACQHAQGIARLHKRQHPVQQGWGLKGA ATLAVLLGVFFLCWGPLFLHLTLIAVCPQHPTCNCIVKNFKLFLALIICNAIVDPLIYAF RSQELRKTLKEVLLFSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins which activate adenylate cyclase. The MC1R plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the regulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MC1R and what is its role in pigmentation?

The melanocortin-1 receptor (MC1R) is a G protein-coupled receptor that functions as a key regulator of melanism across numerous species. When activated by melanocortin peptides like α-melanocyte stimulating hormone (αMSH), MC1R stimulates the production of eumelanin (brown/black pigment) rather than pheomelanin (yellow/red pigment). This receptor is highly polymorphic in many populations, with specific variants associated with distinct coat color phenotypes. In evolutionary studies, MC1R has been implicated in adaptive coat color changes in diverse species from rock pocket mice to toucans and various primates . The molecular signaling pathway primarily involves cAMP production, which subsequently activates the transcription factor CREB, ultimately leading to changes in pigment synthesis.

What are the unique characteristics of ruffed lemur MC1R compared to other primates?

Ruffed lemur (Varecia variegata variegata) MC1R exhibits several distinctive features compared to other primate MC1Rs. Most notably, it demonstrates exceptionally high constitutive (basal) activity, even in the absence of ligand binding . This high constitutive activity is associated with the presence of the E94K mutation, which has been linked to constitutive activation in multiple species . Interestingly, despite this high basal activity, ruffed lemur MC1R does not display measurable binding to melanocortin peptides like NDP-MSH and α-MSH in standard radioligand-binding assays . This contrasts sharply with MC1Rs from hominoids (humans, orangutans) and Old World monkeys (colobus, langur, macaque) which exhibit varying degrees of affinity for these ligands. The combination of high constitutive activity and absence of detectable ligand binding makes ruffed lemur MC1R particularly valuable for studying the structural basis of receptor activation independent of ligand interaction.

How does the E94K mutation affect MC1R function and pigmentation?

The E94K mutation (also referenced as E92K in some studies) represents a glutamic acid to lysine substitution at position II:20/2.60 in transmembrane helix II of the MC1R protein. This mutation has profound effects on MC1R function by:

  • Inducing pronounced constitutive activity, leading to cAMP accumulation and CREB activation even in the absence of ligand stimulation .

  • Promoting constitutive recruitment of β-arrestin, suggesting activation of specific signaling pathways .

  • Interestingly, not inducing constitutive ERK1/2 phosphorylation or increasing internalization rates, indicating biased constitutive activity .

Studies in mice have shown that this mutation creates a receptor conformation that mimics the activated state but is distinct from the αMSH-induced activation . The functional consequence of this mutation appears to be linked to melanism, as the constitutive activity drives continuous eumelanin production. Comparative analyses across primates show that ruffed lemurs with this mutation display among the highest levels of basal activity observed in primate MC1Rs .

What are the optimal approaches for expressing and purifying recombinant V. variegata MC1R?

For successful expression and purification of recombinant V. variegata MC1R, researchers should consider the following methodological approach:

  • Expression System Selection: Mammalian expression systems are generally preferred over bacterial systems due to the need for proper post-translational modifications and membrane insertion. HEK293 cells have been successfully used for primate MC1R expression studies .

  • Vector Design: The expression vector should include a strong promoter (e.g., CMV), appropriate trafficking signals, and ideally a tag system for purification and detection. Common tags include FLAG, His6, or HA epitopes placed at either the N-terminus (after the signal peptide) or C-terminus.

  • Transfection Optimization: Lipid-based transfection methods typically yield good results for MC1R expression. Stable cell lines may be preferred for large-scale purification efforts, while transient transfection is suitable for functional assays.

  • Membrane Extraction and Solubilization: Given the high constitutive activity of ruffed lemur MC1R, special attention should be paid to maintaining receptor stability during extraction. Mild detergents (DDM, LMNG) at optimal concentrations are crucial for maintaining functional integrity.

  • Verification Methods: Western blotting, immunofluorescence microscopy for cellular localization, and functional assays (cAMP accumulation) should be employed to confirm successful expression of functional receptor .

When working with ruffed lemur MC1R, researchers should be particularly aware of its high constitutive activity, which may affect expression levels due to potential cytotoxicity in some expression systems.

How should radioligand-binding assays be optimized for MC1Rs with low binding affinity?

Optimizing radioligand-binding assays for MC1Rs with low or undetectable binding affinity, as observed in ruffed lemur MC1R , requires several specialized approaches:

  • Ligand Selection: Since standard melanocortin peptides (α-MSH, NDP-MSH) show no detectable binding to ruffed lemur MC1R, alternative ligands should be considered. High-affinity synthetic antagonists or modified peptides with enhanced binding properties may yield better results.

  • Higher Receptor Density: Increasing the expression level of the receptor can help detect low-affinity interactions. This can be achieved through optimization of expression conditions or using expression systems with amplification capabilities.

  • Modified Assay Conditions:

    • Reducing assay temperature (from 37°C to 4-16°C) can stabilize transient binding interactions

    • Adjusting buffer composition (ions, pH, presence of GTP analogs)

    • Increasing incubation time to allow equilibrium for low-affinity interactions

    • Using higher concentrations of radioligand while maintaining acceptable non-specific binding

  • Alternative Binding Technologies: For receptors like ruffed lemur MC1R where traditional radioligand binding fails, consider:

    • Surface plasmon resonance (SPR)

    • Bioluminescence resonance energy transfer (BRET)

    • Time-resolved fluorescence resonance energy transfer (TR-FRET)

    • Microscale thermophoresis (MST)

  • Positive Controls: Include MC1Rs with known binding properties (e.g., human, orangutan) in parallel experiments to validate assay functionality .

The absence of detectable binding despite high constitutive activity in ruffed lemur MC1R suggests a unique conformational state that warrants specialized approaches to characterize ligand interactions.

What methods are most effective for measuring constitutive activity of recombinant MC1R?

Given the high constitutive activity observed in ruffed lemur MC1R , effective measurement approaches include:

  • cAMP Accumulation Assays:

    • Real-time cAMP sensors (e.g., EPAC-based BRET sensors)

    • Traditional endpoint assays (EIA, RIA, or TR-FRET-based)

    • Include phosphodiesterase inhibitors (e.g., IBMX) to prevent cAMP degradation

    • Compare basal levels to those after forskolin stimulation as a positive control

  • CREB Phosphorylation:

    • Western blotting with phospho-specific antibodies

    • Reporter gene assays using CRE-responsive elements

    • These assays can effectively demonstrate downstream signaling activation in the absence of ligand

  • β-Arrestin Recruitment:

    • BRET or FRET-based assays to measure constitutive β-arrestin recruitment

    • Particularly relevant for ruffed lemur MC1R as the E94K mutation induces constitutive β-arrestin recruitment

  • Comparative Analysis Framework:

    • Implement a relative scale for constitutive activity (e.g., + to +++ as used in comparative primate studies)

    • Always include wild-type human MC1R as a reference for baseline activity

    • Include positive controls for high constitutive activity

  • Inverse Agonist Response:

    • Measure the ability of inverse agonists to reduce basal activity

    • The magnitude of inverse agonist effect directly correlates with the degree of constitutive activity

The table below summarizes comparative constitutive activity levels observed across primate MC1Rs, demonstrating the exceptionally high activity in ruffed lemur:

SpeciesMC1R Constitutive Activity LevelKey MC1R Characteristics
Human-Low basal activity, high α-MSH affinity (Ki = 0.494 nmol/l)
Orangutan+Moderate basal activity, moderate α-MSH affinity (Ki = 4.04 nmol/l)
Langur++Higher basal activity, moderate α-MSH affinity (Ki = 1.97 nmol/l)
Macaque+++High basal activity, low α-MSH affinity (Ki = 13.1 nmol/l)
Ruffed Lemur+++Very high basal activity, no detectable ligand binding

How do evolutionary pressures shape MC1R function in different primate lineages?

The evolutionary trajectory of MC1R across primate lineages reveals complex selective pressures that have shaped its function differently among species:

  • Purifying Selection vs. Positive Selection: In most primate lineages, including the Lorisidae family, MC1R appears to be under purifying selection (ω = 0.0912), indicating functional conservation . This contrasts with certain species like the golden lion tamarin (Leontopithecus rosalia) where higher dN/dS ratios suggest relaxed or positive selection .

  • Functional Diversification: Primate MC1Rs show remarkable diversity in functional properties:

    • Binding affinity for melanocortin peptides varies significantly across primates, with human MC1R showing the highest affinity for NDP-MSH and α-MSH

    • Constitutive activity levels range from absent (human) to very high (ruffed lemur, macaque)

    • Response to ligand stimulation varies in magnitude and potency

  • Adaptive Color Evolution: In some primate lineages, specific MC1R variants correlate with adaptive coat color patterns. For example:

    • The E94K mutation in ruffed lemurs is associated with their distinct coat coloration

    • In Lorisidae, which includes the venomous slow loris (Nycticebus), contrasting coat patterns may serve as aposematic signals

  • Convergent Evolution: The E94K mutation appears to have evolved independently in multiple lineages, suggesting convergent evolution toward constitutive activation as an adaptive mechanism for melanism .

Researchers should consider these evolutionary patterns when designing comparative studies of recombinant MC1R variants, as they provide context for interpreting functional differences.

What structural features of MC1R determine its constitutive activity and ligand binding?

Several key structural features determine MC1R constitutive activity and ligand binding properties:

  • Transmembrane Helix II Position II:20/2.60: The E94K mutation in ruffed lemur MC1R occurs at this position and dramatically increases constitutive activity . This appears to stabilize an active receptor conformation even in the absence of ligand binding.

  • Extracellular Loop 1 (ECL1): Specific residues in ECL1, particularly G102 and L110, have been identified as critical for maintaining the constitutively active conformation induced by the E94K mutation . Alanine substitutions at these positions abolish constitutive activity without affecting αMSH-mediated activation.

  • Ligand Binding Pocket: The binding pocket for melanocortin peptides involves residues from multiple transmembrane domains. The absence of detectable binding in ruffed lemur MC1R despite high constitutive activity suggests that the active conformation induced by E94K differs from that induced by αMSH .

  • Receptor Conformational States: Evidence suggests that the E94K mutation induces an active conformation distinct from that induced by αMSH , indicating multiple activation pathways for MC1R that can be exploited for targeted receptor engineering.

For researchers working with recombinant V. variegata MC1R, focusing on these structural elements through mutational analysis and molecular modeling would provide valuable insights into the unique activation mechanism of this receptor variant.

What are the functional differences between MC1R constitutive activity and ligand-induced activity?

The functional differences between constitutive and ligand-induced MC1R activity represent a sophisticated aspect of receptor biology, particularly evident in the ruffed lemur MC1R:

  • Signaling Pathway Bias:

    • Constitutive activity induced by the E94K mutation shows biased signaling - it activates cAMP production and recruits β-arrestin but does not induce ERK1/2 phosphorylation or increase internalization rates

    • Ligand-induced activation typically engages a broader spectrum of signaling pathways

  • Structural Requirements:

    • Constitutive activity of E94K MC1R specifically requires intact ECL1 residues (G102, L110)

    • Ligand-induced activation is independent of these ECL1 residues

    • This suggests different conformational stabilization mechanisms for each activation mode

  • Regulatory Mechanisms:

    • Constitutively active MC1Rs may have altered susceptibility to regulatory processes like desensitization and internalization

    • The absence of increased internalization for E94K MC1R despite constitutive activity indicates differential engagement with endocytic machinery

  • Physiological Impact:

    • Constitutive activity provides constant baseline signaling independent of ligand availability

    • This may be particularly advantageous for stable melanin production in species like ruffed lemurs

    • Ligand-induced activation allows for dynamic regulation in response to changing conditions

Understanding these functional differences is crucial for researchers using recombinant V. variegata MC1R as a model system for studying receptor activation mechanisms and for developing targeted receptor modulators.

How can researchers overcome challenges in expressing functionally active recombinant MC1R?

Researchers working with recombinant MC1R, especially constitutively active variants like that of V. variegata, may encounter several challenges that can be addressed through specific strategies:

  • Low Expression Levels:

    • Optimize codon usage for the expression system

    • Use expression vectors with chaperon proteins to aid proper folding

    • Consider inducible expression systems to minimize cytotoxicity from constitutive activity

    • Test different signal peptides to improve membrane targeting

  • Functional Assessment When Binding Is Undetectable:

    • For variants like ruffed lemur MC1R where standard radioligand binding fails , focus on functional readouts like cAMP accumulation

    • Implement constitutive activity assays rather than ligand-dependent assays

    • Consider reporter gene systems driven by cAMP-responsive elements

  • Protein Stability Issues:

    • Include cholesterol or specific lipids during purification to maintain native-like membrane environment

    • Optimize buffer conditions (pH, salt concentration, glycerol percentage)

    • Screen various detergents at different concentrations to identify optimal solubilization conditions

  • Verification Strategies:

    • Use multiple independent assays to confirm functional expression

    • Compare expression and function to well-characterized MC1R variants like human or macaque

    • Implement positive controls for each functional assay

  • Chimeric Receptor Approach:

    • For difficult-to-express variants, create chimeric receptors with sections from better-expressing MC1Rs

    • This approach can help identify problematic regions while maintaining key functional domains

    • The successful use of chimeras has been demonstrated in identifying ECL1 regions critical for E94K function

By systematically addressing these challenges, researchers can improve the reliability and reproducibility of recombinant V. variegata MC1R studies.

What controls are essential when studying constitutive activity of recombinant MC1R?

When investigating the constitutive activity of recombinant MC1R, especially variants with high basal activity like ruffed lemur MC1R, the following controls are essential:

  • Negative Controls for Basal Activity:

    • Non-transfected cells to establish true baseline

    • Human MC1R-transfected cells as a reference for low constitutive activity

    • Mock-transfected cells with empty vector

  • Positive Controls for Activated States:

    • Forskolin stimulation to directly activate adenylyl cyclase

    • Well-characterized constitutively active GPCR (e.g., β2-adrenergic receptor mutants)

    • If possible, macaque MC1R as a known high constitutive activity primate receptor

  • Validation Controls for Constitutive Activity:

    • Inverse agonist treatment to confirm that basal activity is receptor-dependent

    • Dose-response with increasing receptor expression to confirm expression-dependency of constitutive activity

    • Point mutations known to abolish constitutive activity (e.g., alanine substitutions at G102 and L110 in ECL1)

  • Signaling Pathway Verification:

    • Measurement of multiple downstream effectors (cAMP, CREB phosphorylation, β-arrestin recruitment)

    • Pathway inhibitors to confirm specificity of observed constitutive activity

    • Controls for biased signaling assessment (e.g., ERK1/2 phosphorylation)

  • Expression Level Normalization:

    • Surface expression quantification (flow cytometry, surface ELISA)

    • Total protein expression (Western blot)

    • Normalizing functional data to expression levels for accurate comparisons

Implementing these controls enables accurate assessment of constitutive activity and facilitates meaningful comparisons between wild-type and mutant MC1R variants across species.

How can researchers interpret conflicting functional data for MC1R variants?

When faced with conflicting functional data for MC1R variants, researchers should implement a systematic approach to reconcile discrepancies:

  • Methodological Considerations:

    • Assess differences in experimental systems (cell types, assay formats, detection methods)

    • Compare receptor expression levels across studies, as variations can significantly impact functional readouts

    • Evaluate buffer compositions and assay conditions that might affect receptor conformation and activity

  • Receptor State Analysis:

    • Consider that some MC1R variants (like ruffed lemur MC1R) may exist in unique conformational states that respond differently in various assays

    • The absence of ligand binding despite high constitutive activity in ruffed lemur MC1R illustrates how different functional readouts might appear contradictory

  • Data Integration Framework:

    • Develop a comprehensive model incorporating all available data points

    • Assign relative weights to different assays based on their sensitivity and specificity

    • Use multiple complementary assays to build a more complete functional profile

  • Evolutionary Context:

    • Consider how selective pressures might have shaped MC1R function differently across species

    • The variation in MC1R properties across primates (from human to ruffed lemur) demonstrates that functional divergence is expected and biologically meaningful

  • Reconciliation Strategies:

    • Create chimeric receptors to isolate domains responsible for discrepant functions

    • Perform site-directed mutagenesis to test specific hypotheses about structure-function relationships

    • The identification of ECL1 residues critical for E94K-induced constitutive activity provides an example of successfully resolving seemingly conflicting observations

By approaching conflicting data as an opportunity to deepen mechanistic understanding rather than as experimental failures, researchers can gain unique insights into the complex functional landscape of MC1R variants.

What emerging technologies could advance our understanding of recombinant MC1R function?

Several cutting-edge technologies hold promise for deepening our understanding of recombinant V. variegata MC1R function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Capturing the unique active conformation of constitutively active ruffed lemur MC1R

    • Comparing structural differences between ligand-bound and constitutively active states

    • Visualizing interaction interfaces with signaling partners like G proteins and β-arrestin

  • Advanced Molecular Dynamics Simulations:

    • Modeling the conformational changes induced by the E94K mutation

    • Simulating the dynamic interaction between ECL1 residues and transmembrane domains

    • Predicting ligand binding properties and identifying potential novel binding sites

  • CRISPR-Based Genomic Engineering:

    • Creating isogenic cell lines expressing different MC1R variants

    • Introducing ruffed lemur MC1R into melanocytes to assess pigmentation effects

    • Engineering knock-in animal models to study in vivo effects of constitutive activity

  • Single-Molecule Fluorescence Techniques:

    • Tracking real-time conformational changes in individual MC1R molecules

    • Measuring receptor oligomerization and its impact on constitutive activity

    • Visualizing receptor-effector interactions at the single-molecule level

  • Biosensor Development:

    • Creating sensors that specifically detect the constitutively active conformation

    • Developing real-time reporters of biased signaling pathways

    • Implementing multiplexed detection of multiple signaling outputs simultaneously

These technological approaches would be particularly valuable for understanding the unique properties of ruffed lemur MC1R, including its high constitutive activity despite undetectable ligand binding and its biased signaling profile .

How might research on V. variegata MC1R inform our understanding of melanoma and other MC1R-related diseases?

Research on V. variegata MC1R offers several potential insights for understanding human MC1R-related diseases:

  • Constitutive Activity and Cancer Risk:

    • The high constitutive activity of ruffed lemur MC1R (associated with the E94K mutation) provides a model for studying how constitutive MC1R signaling affects melanocyte proliferation and transformation

    • This could inform our understanding of how MC1R variants influence melanoma susceptibility, as MC1R variants are associated with increased melanoma risk in humans

  • Biased Signaling Implications:

    • The biased constitutive activity observed with the E94K mutation (activating cAMP and β-arrestin pathways but not ERK1/2) offers insights into pathway-specific effects on melanocyte biology

    • This could help identify which signaling pathways are most critical for melanoma development

  • Therapeutic Target Identification:

    • Understanding the structural basis of constitutive activation in V. variegata MC1R could reveal novel druggable sites

    • The critical role of ECL1 residues (G102, L110) in maintaining constitutive activity suggests potential targets for modulating MC1R function

  • Pediatric Melanoma Insights:

    • Data on MC1R variants in childhood/adolescent melanoma show that r variants are more prevalent in young patients

    • The mechanisms by which different constitutively active variants affect melanoma risk could be illuminated by studies of naturally occurring variants like that in ruffed lemurs

  • Evolutionary Medicine Perspective:

    • Comparing MC1R function across primates provides context for understanding human MC1R variants

    • The high diversity in functional properties across primate MC1Rs suggests that human variants should be viewed through an evolutionary lens

By studying a naturally occurring constitutively active MC1R variant in ruffed lemurs, researchers may gain unique insights that complement human studies and potentially identify novel therapeutic approaches for MC1R-related diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.