Recombinant Varicella-zoster virus Envelope protein US9 (ORF65)

Shipped with Ice Packs
In Stock

Description

Biological Function

ORF65 encodes the envelope protein US9, which belongs to the conserved α-herpesvirus US9 family. Its roles include:

  • Viral Morphogenesis: Facilitates secondary envelopment and virion transport .

  • Tegument Localization: Interacts with ORF57 and ORF39 during virion assembly .

  • Dispensability: Deletion studies show ORF65 is non-essential for VZV replication in skin and T-cell models .

Immunological Assays

  • ELISA: Used as an antigen to detect VZV-specific antibodies .

  • Antibody Production: Generates monoclonal/polyclonal antibodies for immunohistochemistry (IHC) and Western blotting .

Therapeutic Development

  • Vaccine Design: Evaluated in recombinant VZV strains (e.g., OkaΔ65) to assess attenuation and immunogenicity .

  • Oncolytic Vectors: Engineered ORF65-deleted VZV retains oncolytic potency in melanoma models .

Comparative Expression Systems

Recombinant ORF65 is produced in multiple platforms:

SourceTagYieldApplicationsReference
E. coliHisHighStructural studies, antibodies
YeastVariableModerateBiochemical assays

Recent Findings

  • Oncolytic Activity: ORF65 deletion in VZV Ellen-ΔORF8 did not reduce antitumor efficacy in B16-F10 melanoma models .

  • Cross-Reactivity: Anti-ORF65 antibodies detect simian varicella virus (SVV) homologs, aiding comparative pathogenesis studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ORF65; Envelope protein US9; Envelope protein 65; ORF65 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Target Names
ORF65
Target Protein Sequence
MAGQNTMEGEAVALLMEAVVTPRAQPNNTTITAIQPSRSAEKCYYSDSENETADEFLRRI GKYQHKIYHRKKFCYITLIIVFVFAMTGAAFALGYITSQFVG
Uniprot No.

Target Background

Function
Essential for the anterograde spread of the infection throughout the host nervous system. In conjunction with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.
Database Links

KEGG: vg:1487702

Protein Families
Alphaherpesvirinae envelope protein US9 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host Golgi apparatus, host trans-Golgi network. Host cell membrane; Single-pass type II membrane protein.

Q&A

What is the VZV ORF65 protein and where is it located in the viral genome?

The ORF65 gene is located in the unique short region of the varicella-zoster virus genome, which encodes four genes in total. This gene is predicted to encode an 11-kDa protein, although antibodies to ORF65 protein have been shown to immunoprecipitate a 16-kDa protein from the membrane fraction of VZV-infected cells. The discrepancy between predicted and observed molecular weight may be attributed to post-translational modifications, particularly phosphorylation .

What is the cellular localization pattern of ORF65 protein in infected cells?

VZV ORF65 protein primarily localizes to the Golgi apparatus in virus-infected cells. This localization pattern is significant because it differs from its herpes simplex virus homolog, which is reported to be located in the nucleus of infected cells and in virions as a tegument protein. Instead, VZV ORF65 more closely resembles its pseudorabies virus homolog in terms of subcellular localization, being found in the Golgi apparatus of infected cells and in virions as a type II membrane protein .

How is ORF65 protein post-translationally modified?

The ORF65 protein undergoes phosphorylation, specifically by cellular casein kinase II. Interestingly, studies have demonstrated that the VZV-encoded protein kinases ORF47 and ORF66 are not required for this phosphorylation, suggesting a dependence on host cell machinery for this post-translational modification. This phosphorylation may play a role in the protein's function, though the precise implications require further investigation .

Is the ORF65 protein essential for VZV replication?

No, the ORF65 protein has been experimentally determined to be dispensable for viral replication in multiple contexts. Studies using VZV with large deletions in ORF65 have demonstrated that the virus can replicate effectively in cell culture without this protein. Similarly, using the SCID-hu mouse model with an ORF65 deletion mutant generated from a cosmid system constructed from a low-passage clinical isolate (P-Oka), researchers demonstrated that the ORF65 protein is dispensable for viral replication in skin and T cells, which are critical host cell targets during primary VZV infection .

What techniques are most effective for generating recombinant VZV with modified ORF65?

Two primary methods have proven effective for generating recombinant VZV with modifications to ORF65:

  • Cosmid System Approach: Researchers have successfully generated an ORF65 deletion mutant using a cosmid system constructed from the genome of a low-passage clinical isolate (P-Oka). This approach involves fragmenting the viral genome into overlapping cosmids that can be manipulated in bacterial systems before being recombined to generate intact viruses with specific mutations .

  • BAC-Based Reverse Genetics System: More recently, bacterial artificial chromosome (BAC)-based reverse genetics systems have been employed for manipulating the VZV genome. This approach allows for site-specific genetic manipulations using the Lambda Red recombineering system, which enables precise deletions, insertions, or modifications of viral genes including ORF65. For example, researchers have constructed oncolytic VZVs based on the vaccine Oka strain and the laboratory strain Ellen using BAC-based systems .

The choice between these approaches depends on the specific research question, available laboratory resources, and desired downstream applications.

How can researchers differentiate between wild-type and recombinant ORF65 expression in experimental systems?

To differentiate between wild-type and recombinant ORF65 expression, researchers can employ several complementary techniques:

  • Immunoblotting with specific antibodies: When modifications include epitope tags or alter the molecular weight, immunoblotting can readily distinguish between variants.

  • Fluorescent labeling approaches: For tracking VZV infection dynamics, researchers have successfully employed differential labeling techniques. For example, VZV-infected inoculum cells (input) can be labeled with fluorescent cell dyes, while uninfected (output) cells can be monitored for newly synthesized viral proteins, including ORF65, using confocal immunofluorescence microscopy .

  • PCR-based detection: Primers designed to span modified regions can distinguish between wild-type and recombinant sequences.

  • Functional assays: Since ORF65 localizes to the Golgi apparatus, co-localization studies with Golgi markers can confirm proper trafficking of recombinant proteins compared to wild-type.

What are the optimal expression systems for producing recombinant ORF65 protein for in vitro studies?

The optimal expression systems for producing recombinant ORF65 protein depend on the specific research objectives:

  • Bacterial Expression Systems: While useful for producing high yields of protein, bacterial systems may not provide appropriate post-translational modifications. Since ORF65 is naturally phosphorylated by casein kinase II, this should be considered when interpreting results from bacterially-expressed protein .

  • Mammalian Expression Systems: These provide more natural post-translational modifications and trafficking. Human or primate cell lines such as ARPE-19 (arising retinal pigment epithelia-19) cells have been successfully used in VZV research and would be appropriate for ORF65 expression .

  • Baculovirus Expression Systems: These offer a compromise between high yield and eukaryotic post-translational processing, making them suitable for biochemical and structural studies of ORF65.

The choice of expression system should be guided by whether the research focuses on protein structure, function, or interactions, and whether post-translational modifications are critical to the investigation.

How can ORF65 deletion mutants be utilized in oncolytic virotherapy applications?

ORF65 deletion mutants offer several advantages in oncolytic virotherapy applications:

  • Enhanced Safety Profile: Since ORF65 belongs to the evolutionarily conserved α-herpesvirus US9 family implicated in anterograde axonal transport of the virus, its deletion may reduce neurovirulence while preserving oncolytic potential. This property is particularly valuable for reducing off-target effects in cancer treatment .

  • Combination with Other Modifications: Researchers have constructed VZV with multiple modifications, including ORF65 deletion combined with other attenuating mutations. For example, Ellen-ΔORF8-tet-off-scIL12 represents a novel VZV-based oncolytic virotherapy platform where both ORF8 (encoding viral deoxyuridine triphosphatase) and potentially ORF65 are deleted to attenuate virulence while preserving oncolytic efficacy .

  • Transgene Insertion: The deletion of ORF65 creates genomic space that can potentially be utilized for inserting therapeutic transgenes, such as immunomodulatory cytokines to enhance anti-tumor immune responses.

In the MeWo melanoma xenograft model, VZV with gene deletions demonstrated potent antitumor efficacy, and these approaches can be further refined for therapeutic applications .

What role does ORF65/US9 play in VZV neurotropism, and how can recombinant versions help study this phenomenon?

The role of ORF65/US9 in VZV neurotropism appears to be related to its function in virus trafficking. As a member of the α-herpesvirus US9 family, ORF65 is implicated in anterograde axonal transport of the virus, which is crucial for viral spread within the nervous system .

Recombinant versions of ORF65 can help study neurotropism through:

  • Domain Mutation Analysis: Creating recombinant viruses with specific mutations in functional domains of ORF65 can identify regions critical for neuronal transport.

  • Comparative Studies: Constructing chimeric proteins where domains of ORF65 are swapped with counterparts from other herpesviruses (such as HSV or PRV) can elucidate which regions confer neurotropic properties.

  • Live-Cell Imaging: Fluorescently tagged recombinant ORF65 proteins can be used to track viral transport in neuronal cell cultures in real-time, providing insights into the dynamics of viral trafficking.

  • Ex Vivo Models: ORF65 mutants can be tested in ex vivo models of human dorsal root ganglia to assess the impact on viral latency and reactivation.

These approaches allow researchers to dissect the specific contributions of ORF65 to VZV's neurotropic properties, with implications for understanding and potentially treating conditions like herpes zoster (shingles).

How do the post-translational modifications of ORF65 affect its function in viral assembly and transport?

The post-translational modifications of ORF65, particularly phosphorylation by casein kinase II, likely play critical roles in its function:

  • Protein-Protein Interactions: Phosphorylation may regulate interactions between ORF65 and other viral or cellular proteins involved in virion assembly and trafficking. Creating recombinant ORF65 with mutations at phosphorylation sites can help determine how these modifications affect protein binding partners.

  • Subcellular Localization: Phosphorylation status may influence the proper localization of ORF65 to the Golgi apparatus. Studies comparing wild-type ORF65 with phospho-mutant variants can evaluate changes in trafficking patterns using immunofluorescence microscopy.

  • Functional Activity: The phosphorylation state may affect the functional activity of ORF65 in viral egress or cell-to-cell spread. Recombinant viruses expressing phospho-mimetic or phospho-deficient ORF65 variants can be assessed for alterations in viral spread kinetics.

  • Stability and Turnover: Phosphorylation might influence the stability and turnover rate of ORF65 during infection. Pulse-chase experiments with recombinant variants can determine if phosphorylation affects protein half-life.

Understanding these relationships is crucial for comprehending the role of ORF65 in the VZV life cycle and potentially for developing targeted interventions.

What are the key considerations when designing experiments to study ORF65 function in viral replication cycles?

When designing experiments to study ORF65 function in viral replication cycles, researchers should consider the following key factors:

  • Time-resolved analysis: Since VZV is highly cell-associated in cell culture and cell-free virus yields are typically too low for synchronous infections, special techniques are required for time-resolved analyses. Differential labeling of infected and uninfected cells (using fluorescent dyes or nanogold particles) allows evaluation of newly infected cells at defined intervals by confocal immunofluorescence or electron microscopy .

  • Cell type selection: Different cell types may reveal different aspects of ORF65 function. Human fibroblasts (like HELF cells) are commonly used for general VZV replication studies, while neuronal cells would be more appropriate for studying the role of ORF65 in axonal transport.

  • Control design: Appropriate controls should include:

    • Wild-type virus for comparison with ORF65 mutants

    • Complementation experiments to verify phenotypes are specifically due to ORF65 modification

    • Uninfected cells as negative controls

  • Detection methods: For tracking ORF65 expression and localization, researchers have successfully used:

    • Confocal immunofluorescence with specific antibodies

    • Electron microscopy for virion localization

    • In situ hybridization for viral DNA replication

  • Replication cycle timing: When studying ORF65's role in the VZV replication cycle, it's important to note that the complete productive cycle of VZV infection in a single cell occurs in 9-12 hours, with viral nucleocapsid assembly and mature enveloped virion formation detectable by 9-12 hours post-infection .

How should researchers approach experimental design when comparing ORF65 with its homologs in other herpesviruses?

When comparing ORF65 with its homologs in other herpesviruses, researchers should approach experimental design with careful consideration of the following factors:

  • Sequence and structural analysis: Begin with comprehensive bioinformatic analyses to identify:

    • Conserved domains and motifs across herpesvirus homologs

    • Unique features of VZV ORF65 compared to other homologs

    • Predicted functional sites (e.g., phosphorylation sites)

  • Expression system consistency: Use the same expression systems when comparing homologs to minimize system-specific variables. Mammalian cell lines permissive for multiple herpesviruses are preferable for comparative studies.

  • Functional complementation experiments: Design experiments to test whether:

    • The HSV homolog can functionally replace VZV ORF65

    • The PRV homolog can functionally replace VZV ORF65

    • Chimeric proteins containing domains from different homologs retain function

  • Localization studies: Compare subcellular localization patterns using:

    • Consistent cell types across experiments

    • Same detection methods and imaging parameters

    • Co-localization with appropriate cellular markers

  • Experimental table design: A systematic approach can be organized as follows:

Experimental VariableVZV ORF65HSV HomologPRV HomologAnalytical Method
Molecular Weight16 kDa (observed)To be determinedTo be determinedImmunoblotting
Subcellular LocalizationGolgi apparatusNuclear/TegumentGolgi apparatusImmunofluorescence
Virion LocalizationType II membrane proteinTegumentType II membrane proteinImmuno-EM
PhosphorylationBy casein kinase IITo be comparedTo be comparedPhospho-specific antibodies
Deletion PhenotypeDispensable for replicationTo be comparedTo be comparedGrowth curve analysis

This table format allows for systematic comparison across homologs and facilitates identification of conserved and divergent properties .

What experimental variables should be controlled when studying the role of ORF65 in viral trafficking?

When studying the role of ORF65 in viral trafficking, several experimental variables must be carefully controlled:

  • Cell type and culture conditions:

    • Neuronal cells are essential for axonal transport studies

    • Microfluidic chambers or compartmentalized culture systems help distinguish anterograde from retrograde transport

    • Standardized culture conditions (medium, supplements, passage number) minimize variability

  • Viral inoculum standardization:

    • Equivalent infectious titers across compared viruses

    • Similar particle-to-PFU ratios

    • Consistent cell-associated virus preparation methods

  • Temporal considerations:

    • Synchronized infection is challenging with VZV but can be approximated using the differential labeling techniques

    • Fixed time points should be carefully selected based on the VZV replication cycle (9-12 hours for a complete cycle)

    • Live-cell imaging intervals must be optimized to capture transport events

  • Detection methods:

    • Consistency in antibodies or fluorescent tags used across experiments

    • Standardized imaging parameters (exposure times, gain settings)

    • Appropriate markers for cellular compartments involved in trafficking

  • Quantification approaches:

    • Automated tracking systems with defined parameters

    • Blinded analysis to prevent observer bias

    • Statistical methods appropriate for the distribution of transport measurements

By controlling these variables, researchers can more confidently attribute observed trafficking phenotypes to ORF65 function rather than experimental artifacts.

How should researchers interpret phenotypic differences between wild-type and ORF65-deleted VZV strains?

When interpreting phenotypic differences between wild-type and ORF65-deleted VZV strains, researchers should consider several factors:

  • Context-dependency of phenotypes: The importance of ORF65 may vary by experimental context. For example, while ORF65-deleted viruses show no major replication defects in cell culture and in skin and T cells of the SCID-hu mouse model, there might be subtle phenotypes in specific cell types or under particular conditions .

  • Compensatory mechanisms: The absence of a strong phenotype might reflect compensatory functions provided by other viral or cellular proteins. Researchers should consider:

    • Double or multiple deletion mutants to identify redundant functions

    • Overexpression studies to identify saturated systems

    • Stress conditions that might reveal conditional phenotypes

  • Quantitative vs. qualitative differences: Subtle quantitative differences (e.g., slight growth delays) should be distinguished from qualitative differences (e.g., complete block of a specific function).

  • Statistical analysis framework: Appropriate statistical methods should be applied:

    • Growth curve comparisons require repeated measures analysis

    • Single-cell analyses may require non-parametric methods

    • Multiple comparison corrections for experiments testing several conditions

  • Comparison to reference strains: When studying recombinant viruses, researchers should compare results to both:

    • The immediate parent strain used for genetic manipulation

    • Standard laboratory strains (like Ellen) and clinical isolates (like P-Oka)

What statistical approaches are most appropriate for analyzing the effects of ORF65 mutations on viral spread and pathogenesis?

The most appropriate statistical approaches for analyzing ORF65 mutation effects depend on the experimental design and data characteristics:

  • For viral growth kinetics:

    • Repeated measures ANOVA or mixed-effects models for growth curves

    • Area under the curve (AUC) analysis followed by t-tests or non-parametric alternatives

    • Viral doubling time calculations with confidence interval estimation

  • For plaque size/morphology analyses:

    • Non-parametric tests (Mann-Whitney U) if distributions are non-normal

    • ANOVA with post-hoc tests for multiple strain comparisons

    • Image analysis algorithms with bootstrap confidence intervals

  • For in vivo pathogenesis studies:

    • Survival analysis using Kaplan-Meier curves and log-rank tests

    • Fisher's exact test for categorical outcomes

    • Mixed-effects models for repeated measurements on the same animals

  • For molecular interaction studies:

    • Correlation analyses for co-localization studies

    • ANOVA for comparing binding affinities

    • Multiple regression for identifying key determinants of interaction strength

  • Meta-analytical approaches:

    • For integrating data across multiple experiments or studies

    • Random-effects models to account for between-experiment heterogeneity

    • Forest plots to visualize effect sizes and confidence intervals

When analyzing oncolytic potential, researchers have successfully used statistics to compare tumor growth curves and animal survival between wild-type viruses and those with deletion mutations, including ORF65 deletions .

How can researchers distinguish between direct effects of ORF65 deletion and indirect consequences on viral replication?

Distinguishing between direct effects of ORF65 deletion and indirect consequences requires a multi-faceted experimental approach:

  • Complementation studies:

    • Trans-complementation: Express ORF65 in trans from a separate vector or stable cell line

    • Cis-complementation: Reintroduce ORF65 to its native locus in the deletion mutant

    • Rescue of specific phenotypes indicates direct involvement of ORF65

  • Temporal dissection of the viral life cycle:

    • Using time-resolved analyses as demonstrated in VZV studies

    • Examine each stage independently: entry, gene expression, DNA replication, assembly, egress

    • The specific stage affected can indicate whether ORF65's role is direct or indirect

  • Protein interaction studies:

    • Immunoprecipitation to identify ORF65 binding partners

    • Proximity labeling approaches to identify proteins in the vicinity of ORF65

    • Changes in these interactions upon ORF65 deletion can reveal direct molecular functions

  • Structural analyses:

    • Examine virion structure in wild-type versus ORF65-deleted viruses using electron microscopy

    • Assess specific defects in virion components or organization

  • Molecular function assays:

    • If ORF65 has enzymatic activity, direct biochemical assays

    • For transport functions, direct tracking of viral components with and without ORF65

These approaches have been applied to study the functions of various VZV proteins, including ORF65, and can help researchers determine whether observed phenotypes are directly attributable to ORF65 function or are secondary consequences of its deletion .

How are recent technological advances enhancing our ability to study ORF65 function?

Recent technological advances have significantly enhanced our ability to study ORF65 function:

  • BAC-based reverse genetics systems: These systems, as demonstrated in recent VZV research, allow precise manipulation of the viral genome including the ORF65 gene. The Lambda Red recombineering system enables site-specific integration and genetic manipulations within the large VZV genome (approximately 125 kb). This technology has facilitated the creation of recombinant viruses with specific modifications to ORF65 and other genes .

  • CRISPR-Cas9 genome editing: While not explicitly mentioned in the search results, this technology can potentially be applied to make precise modifications to ORF65 in the viral genome or to modify cellular factors that interact with ORF65.

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed localization studies

    • Live-cell imaging combined with fluorescently tagged virion components

    • These techniques build upon the time-resolved confocal immunofluorescence approaches previously used in VZV research

  • Proteomics approaches:

    • Mass spectrometry-based identification of ORF65 interaction partners

    • Quantitative proteomics to compare wild-type and mutant viruses

    • Phosphoproteomics to identify specific phosphorylation sites on ORF65

  • In vitro models of human tissues:

    • Organoids and tissue-on-chip technologies

    • 3D neuronal culture systems that better recapitulate in vivo environments

    • These models provide more physiologically relevant contexts for studying ORF65 function

These technological advances are enabling more precise, comprehensive, and physiologically relevant studies of ORF65 function in the context of VZV biology.

What are the most promising research directions for understanding ORF65's role in VZV pathogenesis?

The most promising research directions for understanding ORF65's role in VZV pathogenesis include:

  • Neurotropism and axonal transport studies:

    • Further investigation of ORF65's role in anterograde axonal transport

    • Development of neuronal models that better recapitulate human ganglia

    • Comparative studies with other alphaherpesvirus US9 homologs to identify conserved mechanisms

  • Role in immune evasion and modulation:

    • Investigation of potential interactions between ORF65 and host immune components

    • Studies in humanized mouse models to assess impact on immune responses

    • This direction is particularly relevant given the development of VZV-based oncolytic viruses armed with immunomodulatory genes

  • Structural biology approaches:

    • Determination of ORF65 protein structure using cryo-EM or X-ray crystallography

    • Mapping of functional domains and interaction interfaces

    • Structure-guided design of ORF65 variants with altered functions

  • Systems biology integration:

    • Network analyses to place ORF65 within the context of viral-host protein interaction networks

    • Multi-omics approaches to comprehensively assess the impact of ORF65 deletion

    • Mathematical modeling of viral trafficking with and without ORF65

  • Translational applications:

    • Further development of ORF65-deleted VZV as oncolytic viral vectors

    • Exploration of ORF65-deleted VZV as potential vaccine vectors

    • These applications build on the finding that ORF65 is dispensable for replication in key cell types

These research directions leverage both basic science and translational approaches to more fully understand ORF65's role in VZV pathogenesis.

How might ORF65 deletion contribute to the development of next-generation attenuated VZV vaccines?

ORF65 deletion could contribute significantly to next-generation attenuated VZV vaccines in several ways:

  • Enhanced safety profile:

    • Since ORF65 belongs to the US9 family implicated in anterograde axonal transport, its deletion might reduce neurotropism and potential for latency establishment

    • This could lower the risk of vaccine strain reactivation and associated herpes zoster

    • The dispensability of ORF65 for replication in skin and T cells suggests that immunogenicity would be maintained despite attenuation

  • Genetic stability advantages:

    • A defined genetic deletion provides a stable attenuation marker

    • Lower risk of reversion to virulence compared to point mutations

    • This addresses potential concerns with current live attenuated vaccines

  • Combination with other attenuating mutations:

    • As demonstrated in oncolytic virus development, ORF65 deletion can be combined with other attenuating mutations like ORF8 deletion

    • This multi-layered approach to attenuation could provide redundant safety features

  • Vector capacity enhancement:

    • The genomic space created by ORF65 deletion could potentially accommodate additional antigens

    • This might allow development of polyvalent vaccines targeting multiple pathogens

  • Monitoring advantages:

    • ORF65-deleted vaccine strains would be readily distinguishable from wild-type VZV

    • This facilitates post-marketing surveillance and epidemiological studies

These potential advantages make ORF65 deletion a promising approach for developing safer and more effective next-generation VZV vaccines, building on the demonstrated dispensability of this gene for viral replication in key target cells .

What are common challenges in working with recombinant VZV systems, and how can they be addressed?

Working with recombinant VZV systems presents several challenges that researchers should anticipate and address:

  • Cell-associated nature of VZV:

    • Challenge: VZV is highly cell-associated in culture with low cell-free virus yields, making synchronous infection difficult.

    • Solution: Use differential labeling techniques as demonstrated in VZV research, where infected inoculum cells are labeled with fluorescent dyes to distinguish them from newly infected cells during analysis .

  • BAC stability issues:

    • Challenge: The 125 kb VZV genome can be unstable when maintained as a BAC in bacteria.

    • Solution: Use specialized bacterial strains (like SW102) that express the Lambda Red recombineering system to improve stability, and verify BAC integrity by restriction enzyme digestion before virus reconstitution .

  • Reconstitution efficiency:

    • Challenge: Reconstituting infectious virus from BAC DNA can be inefficient.

    • Solution: Optimize transfection protocols for specific cell types (like ARPE-19 cells), and consider using helper plasmids expressing immediate-early viral proteins to enhance reconstitution .

  • Slow replication kinetics:

    • Challenge: VZV replicates more slowly than other herpesviruses, extending experimental timelines.

    • Solution: Plan experiments with appropriate time points, knowing that the complete VZV replication cycle takes 9-12 hours in a single cell .

  • Phenotype assessment:

    • Challenge: Subtle phenotypes of recombinant viruses may be difficult to detect.

    • Solution: Employ multiple complementary assays (growth curves, plaque morphology, electron microscopy, etc.) and quantitative approaches with appropriate statistical analysis.

These methodological considerations are crucial for successful experimentation with recombinant VZV systems, including those involving ORF65 modifications.

How can researchers optimize transfection and reconstitution protocols for recombinant VZV expressing modified ORF65?

To optimize transfection and reconstitution protocols for recombinant VZV expressing modified ORF65, researchers should consider the following strategies:

  • Cell line selection:

    • Use highly permissive cell lines for initial reconstitution, such as ARPE-19 cells, which have been successfully used for VZV BAC reconstitution .

    • Consider MeWo cells (human melanoma cell line) for subsequent propagation, as they support robust VZV replication.

  • Transfection method optimization:

    • Compare multiple transfection reagents (lipid-based, polyethylenimine, electroporation) to identify the most efficient for your specific cell type.

    • Optimize DNA:transfection reagent ratios through systematic testing.

    • Consider nucleofection for hard-to-transfect cell types.

  • BAC preparation quality:

    • Use endotoxin-free BAC DNA preparation methods to improve transfection efficiency.

    • Verify BAC integrity by restriction enzyme digestion and pulsed-field gel electrophoresis before transfection.

  • Co-transfection strategies:

    • Co-transfect with plasmids expressing VZV immediate-early proteins (like IE62) to jumpstart the viral replication cycle.

    • For ORF65-modified constructs, consider co-transfection with an ORF65 expression plasmid if the modification might impair initial reconstitution.

  • Post-transfection procedures:

    • Optimize tissue culture conditions (medium composition, serum concentration, cell density).

    • Implement appropriate selection if selection markers are incorporated into the BAC.

    • Monitor for cytopathic effect daily and passage infected cells before complete monolayer destruction.

By systematically optimizing these parameters, researchers can improve the efficiency of reconstituting recombinant VZV expressing modified ORF65 proteins.

What quality control measures should be implemented when working with recombinant ORF65 proteins?

When working with recombinant ORF65 proteins, researchers should implement comprehensive quality control measures:

  • Sequence verification:

    • Confirm the complete sequence of the modified ORF65 gene by Sanger sequencing.

    • Verify the absence of unwanted mutations in the recombinant virus genome, particularly in regions adjacent to engineered changes.

  • Expression verification:

    • Confirm expression levels and molecular weight of recombinant ORF65 by Western blotting.

    • Compare to wild-type ORF65 expression (remembered to be detectable as a 16-kDa protein from the membrane fraction of VZV-infected cells) .

  • Post-translational modification assessment:

    • Verify phosphorylation status using phospho-specific antibodies or mass spectrometry.

    • Compare to wild-type ORF65, which is phosphorylated by casein kinase II .

  • Localization verification:

    • Confirm proper subcellular localization to the Golgi apparatus using immunofluorescence microscopy.

    • Co-stain with established Golgi markers to verify correct targeting .

  • Functional testing:

    • Assess virus growth kinetics comparing wild-type and recombinant viruses.

    • Evaluate virion incorporation of the recombinant ORF65 by immunoelectron microscopy or virion fractionation studies.

  • Stability assessment:

    • Monitor genetic stability of the recombinant virus over multiple passages.

    • Check for potential reversion or compensatory mutations, particularly if the modification affects viral fitness.

What are the key resources available for researchers studying VZV ORF65?

Researchers studying VZV ORF65 have access to several key resources:

  • Genetic tools and materials:

    • BAC clones containing the VZV genome, including the vaccine Oka strain and laboratory strain Ellen, which have been used for constructing recombinant viruses .

    • The Lambda Red recombineering system expressed in SW102 bacterial cells for genetic manipulation of VZV BACs .

    • Cosmid systems constructed from low-passage clinical isolates like P-Oka, which have been used for generating ORF65 deletion mutants .

  • Cell culture systems:

    • Human fibroblasts (HELF cells) commonly used for VZV propagation and study .

    • ARPE-19 cells, which have been successfully used for virus reconstitution from BAC DNA .

    • MeWo melanoma cells, used in xenograft models for studying VZV oncolytic properties .

  • Animal models:

    • SCID-hu mouse model, which has been used to demonstrate that ORF65 is dispensable for viral replication in skin and T cells .

    • Melanoma xenograft models (MeWo) and syngeneic melanoma mouse models (B16-F10-nectin1) used for studying oncolytic properties of VZV .

  • Antibodies and detection tools:

    • Well-characterized antibodies against VZV proteins, including ORF65, which have been used for immunoprecipitation and immunofluorescence studies .

    • DIG-labeled probes for in situ hybridization to detect VZV DNA accumulation .

  • Methods for time-resolved analyses:

    • Differential labeling techniques using fluorescent cell dyes or endocytosed nanogold particles to distinguish input and output cells in infection studies .

These resources form the foundation for successful research on VZV ORF65 and its role in viral biology.

What emerging technologies might further advance our understanding of ORF65 function?

Several emerging technologies show promise for advancing our understanding of ORF65 function:

  • Cryo-electron tomography: This technique can provide detailed structural information about ORF65's organization within the virion at near-atomic resolution, potentially revealing how it interacts with other viral proteins in its native context.

  • Single-molecule imaging: Technologies like single-molecule tracking could visualize the dynamics of individual ORF65 molecules during viral trafficking, providing unprecedented insights into its molecular function in living cells.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 could identify proteins that transiently interact with ORF65 during infection, potentially uncovering new functional connections.

  • Microfluidic organ-on-chip systems: These systems can model complex human tissues, including neuronal networks, providing more physiologically relevant contexts for studying ORF65's role in viral spread and pathogenesis.

  • Machine learning approaches: AI-driven analysis of large datasets could identify subtle phenotypic effects of ORF65 modifications that might be missed by conventional analyses.

  • Single-cell transcriptomics/proteomics: These technologies could reveal cell-to-cell variability in responses to wild-type versus ORF65-deleted viruses, potentially uncovering functions that are masked in population-level analyses.

  • In situ structural biology: Techniques like correlative light and electron microscopy (CLEM) combined with cryo-focused ion beam milling could visualize ORF65 in its native cellular environment at molecular resolution.

These technologies extend beyond conventional approaches and have the potential to provide novel insights into ORF65 function that were previously inaccessible.

How should researchers integrate findings about ORF65 into the broader context of herpesvirus biology?

To integrate findings about ORF65 into the broader context of herpesvirus biology, researchers should:

  • Conduct comparative analyses across herpesviruses:

    • Compare VZV ORF65 with its homologs in other alphaherpesviruses, noting that it more closely resembles its pseudorabies virus homolog than its herpes simplex virus homolog in terms of localization and function .

    • Extend comparisons to more distantly related beta- and gammaherpesviruses to identify evolutionarily conserved principles.

  • Map onto core viral processes:

    • Position ORF65 findings within fundamental herpesvirus processes (entry, gene expression, DNA replication, assembly, egress).

    • The localization of ORF65 to the Golgi apparatus and its presence in virions as a type II membrane protein suggest roles in assembly and/or egress .

  • Consider host-pathogen interaction networks:

    • Integrate ORF65 functions into the broader context of viral manipulation of host cell processes.

    • Examine potential intersections with immune evasion strategies common across herpesviruses.

  • Apply insights to translational applications:

    • Use knowledge about ORF65 to inform development of next-generation vaccines or oncolytic virotherapies.

    • The dispensability of ORF65 for replication in skin and T cells has implications for attenuated vaccine design .

  • Contribute to community resources and databases:

    • Submit standardized data to herpesvirus-specific databases.

    • Participate in nomenclature standardization efforts to facilitate cross-virus comparisons.

  • Bridge basic and clinical research:

    • Connect molecular findings about ORF65 to clinical manifestations of VZV infection.

    • Consider how ORF65 properties might influence viral tropism, spread, or pathogenesis in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.