Recombinant Varicella-zoster virus Envelope glycoprotein K (gK)

Shipped with Ice Packs
In Stock

Description

Introduction to Varicella-zoster virus Glycoprotein K

Varicella-zoster virus is a human alphaherpesvirus responsible for causing chickenpox (varicella) during primary infection and herpes zoster (shingles) upon reactivation after a period of latency . The VZV genome encodes for six well-characterized glycoproteins (gB, gC, gE, gH, gI, and gL) and two putative glycoproteins, including gK and gM . Among these, glycoprotein K, encoded by open reading frame 5 (ORF5), represents a conserved protein across alphaherpesviruses with essential functions in viral replication.

Primary Structure and Domains

VZV gK consists of 340 amino acids with a predicted molecular weight of approximately 40,000 daltons when fully processed in infected cells . The protein contains multiple hydrophobic domains and potential glycosylation sites that contribute to its complex membrane topology and biological functions. Analysis of the amino acid sequence reveals four major hydrophobic domains, indicating a complex transmembrane structure essential for its biological activity .

Sequence alignment studies demonstrate that VZV gK shares limited but significant homology with its alphaherpesvirus counterparts, exhibiting 28% amino acid identity with HSV-1 gK and 33% identity with PRV gK . This moderate conservation suggests both shared and distinct functional mechanisms across these related viral glycoproteins.

Expression in Infected Cells

Research using polyclonal antibodies raised against a fusion protein containing amino acids 25-122 of gK has enabled the detection and characterization of this glycoprotein in VZV-infected cells . Western blot analysis identified a single 40K protein band in both infected cells and cells transformed to express gK constitutively . This finding confirmed the expression of gK during viral infection and established the molecular weight of the mature protein in cellular contexts.

Subcellular Localization and Trafficking

Immunogold electron microscopy studies have provided valuable insights into the distribution of VZV gK within infected cells. Unlike its HSV-1 counterpart, which primarily localizes to perinuclear sites, VZV gK exhibits a more dispersed pattern throughout the cytoplasm and on the cell surface . This distribution pattern suggests differences in trafficking pathways between these related viral proteins.

VZV gK has been detected at multiple subcellular locations, including the endoplasmic reticulum (ER), Golgi apparatus, and cytoplasmic vesicles . Some forms of the protein appear resistant to endo H digestion, indicating transit through the Golgi and acquisition of complex glycosylation . This trafficking pattern differs from HSV-1 gK, which remains sensitive to endo H, suggesting retention within the ER and nuclear envelope .

Virion Association

A critical finding regarding VZV gK is its presence in the viral envelope. Western blot analysis of purified cell-free virions has confirmed that gK is a structural component of the VZV particle . Immunogold electron microscopy further demonstrated the association of gK with enveloped virions, supporting its classification as an envelope glycoprotein . This virion association contrasts with HSV-1 gK, which has not been conclusively detected in virions, highlighting potential functional differences between these homologous proteins .

Essential Role in Viral Propagation

Studies using VZV cosmid-based recombination systems have established that gK is indispensable for viral replication . When cosmids containing full or partial deletions of the gK gene were transfected into melanoma cells, viral replication was completely abolished . This essential requirement for gK aligns with observations in other alphaherpesviruses, where gK mutants exhibit severe replication defects.

Deletion Mutant Analysis

A series of gK deletion mutants constructed using VZV cosmid DNA derived from the Oka strain has provided valuable insights into the functional domains of this glycoprotein. Both complete deletion of gK and partial deletions affecting the N-terminal or C-terminal regions prevented viral replication when transfected into melanoma cells . These findings indicate that multiple domains of gK contribute to its essential function in the viral life cycle.

Interestingly, attempts to complement VZV gK deletion with HSV-1 gK were unsuccessful, as insertion of the HSV-1 (KOS) gK gene into the endogenous VZV gK site did not restore viral replication . This observation suggests significant functional divergence between these homologous proteins despite their structural similarities.

Complementation Studies

The development of gK-expressing cell lines has facilitated further investigation of gK function through complementation experiments. When gK deletion mutants were transfected into cells constitutively expressing VZV gK, viral plaques indistinguishable from those of intact recombinant Oka (rOka) virus were observed . This successful complementation confirmed that the replication defect in gK deletion mutants was specifically due to the absence of gK rather than secondary effects on other viral genes.

Additionally, the replacement of VZV gK at a non-native AvrII site in the VZV genome restored the phenotypic characteristics of intact rOka virus, further substantiating the specific requirement for this glycoprotein in viral replication .

Potential Functions in Viral Life Cycle

Based on the available data and comparisons with gK homologs in other alphaherpesviruses, VZV gK appears to contribute to multiple aspects of the viral life cycle, including:

  1. Viral egress and envelopment - Similar to HSV-1 gK, VZV gK may participate in the envelopment of capsids and the egress of virions from infected cells .

  2. Membrane fusion - The distribution of gK on the cell surface suggests potential involvement in membrane fusion events during cell-to-cell spread of the virus .

  3. Chaperone function - The widespread distribution of gK in multiple cellular compartments indicates a possible role as a chaperone protein during viral egress .

  4. Virion structure - As a component of the viral envelope, gK likely contributes to virion stability and potentially to receptor interactions during viral entry .

Generation of Recombinant VZV gK

The production of recombinant VZV gK has been accomplished through several approaches that have facilitated its characterization. One method involved the construction of a glutathione S-transferase (GST) fusion protein containing amino acids 25-122 of gK . This fusion protein, expressed in Escherichia coli and purified by gel filtration, served as an antigen for generating polyclonal antibodies against gK .

Another approach utilized cosmid-based recombination systems to engineer VZV genomes with modifications in the gK gene. These methods allowed the generation of recombinant viruses with deletions, insertions, or replacements in gK, enabling functional studies of this glycoprotein in the context of viral replication .

Analysis Techniques for Recombinant gK

Several analytical techniques have been employed to characterize recombinant VZV gK:

  1. In vitro translation - Cell-free translation systems with and without microsomal membranes have revealed the basic properties of unprocessed and processed gK .

  2. Western blotting - Immunoblotting with anti-gK antibodies has allowed detection of the protein in infected cells, transformed cells, and purified virions .

  3. Glycosidase digestion - Treatment with endo H and O-glycosidase has provided insights into the nature of gK glycosylation .

  4. Immunogold electron microscopy - This technique has revealed the subcellular distribution of gK and its association with viral particles .

  5. Transfection of mutant cosmids - The introduction of gK-modified viral genomes into permissive cells has enabled assessment of gK function in viral replication .

Cell Systems for gK Expression

Several cell systems have been utilized for the expression and analysis of recombinant VZV gK:

  1. E. coli - Used for expression of GST-gK fusion proteins for antibody production .

  2. In vitro translation systems - Employed for initial characterization of unprocessed and processed gK .

  3. Melanoma cells - Served as the primary cell type for propagation of VZV and analysis of gK function in viral replication .

  4. gK-transformed cell lines - Established to enable complementation studies with gK deletion mutants .

Functional Comparisons

While VZV gK shares structural similarities with its homologs in other alphaherpesviruses, notable functional differences have been observed. Unlike HSV-1 gK, which remains primarily in perinuclear regions, VZV gK exhibits a more widespread distribution extending to the cell surface . Additionally, VZV gK has been detected in virions, whereas HSV-1 gK has not been conclusively identified as a virion component .

These differences in localization and virion association suggest distinct roles for gK in the respective viral replication cycles. The inability of HSV-1 gK to complement VZV gK deletion further underscores the functional divergence between these homologous proteins .

Evolutionary Conservation

The moderate sequence identity between VZV gK and its homologs (28% with HSV-1 gK and 33% with PRV gK) indicates evolutionary conservation of key functional domains alongside diversification of others . This pattern of conservation suggests adaptation to virus-specific replication strategies while maintaining essential core functions.

Potential Therapeutic Applications

As an essential viral protein, VZV gK represents a potential target for antiviral therapeutics. Compounds that interfere with gK function could potentially inhibit viral replication and thus offer new approaches for treating VZV infections. The development of such inhibitors would require a more detailed understanding of gK structure and function.

Furthermore, recombinant VZV gK could potentially serve as a component of vaccines against VZV. While current VZV vaccines primarily rely on glycoprotein E as the immunodominant antigen, inclusion of additional viral antigens such as gK might enhance vaccine efficacy.

Diagnostic Applications

Recombinant VZV gK could also find application in diagnostic tests for VZV infection. The production of purified recombinant gK would enable the development of serological assays to detect anti-gK antibodies in patient samples, potentially offering complementary approaches to existing diagnostic methods.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
gK; ORF5; Envelope glycoprotein K; Syncytial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-340
Protein Length
Full Length of Mature Protein
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Target Names
gK
Target Protein Sequence
VFTLWYTARVKFEHECVYATTVINGGPVVWGSYNNSLIYVTFVNHSTFLDGLSGYDYSCR ENLLSGDTMVKTAISTPLHDKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIR RMFGPFRSSCELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNAD PISFLYMHKGVTLLMLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIRILAWVVVCTLA IVELISYVRPKPTKDNHLNHINTGGIRGICTTCCATVMSGLAIKCFYIVIFAIAVVIFMH YEQRVQVSLFGESENSQKH
Uniprot No.

Target Background

Function
Glycoprotein that likely modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes. It also plays a role, along with gB, in virus-induced cell-to-cell fusion (syncytia formation), which is extensive during VZV infection in cultured cells.
Protein Families
Alphaherpesvirinae glycoprotein K family
Subcellular Location
Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is VZV glycoprotein K and what genomic region encodes it?

VZV glycoprotein K (gK) is an essential envelope glycoprotein encoded by open reading frame 5 (ORF5) in the VZV genome. It is conserved among alphaherpesviruses, including herpes simplex virus type 1 (HSV-1) and pseudorabies virus (PRV). This glycoprotein is indispensable for viral replication as demonstrated through deletion mutant studies.

What is the molecular weight and structure of VZV gK?

VZV gK is a 40,000-molecular-weight protein as detected by Western blotting. Structurally, gK contains four hydrophobic domains, indicating a complex transmembrane structure. This tertiary structure is critical for its biological function, as demonstrated in studies with HSV-1 gK. The protein has both N-terminal and C-terminal domains that extend extracellularly, and deletions in either of these regions prevent viral replication.

How is VZV gK distributed within infected cells?

Immunogold electron microscopy studies have shown that VZV gK is distributed throughout the cytoplasm of infected cells and on the cell surface. Little background labeling in the nucleus was observed. Importantly, gK was detected on the surface of enveloped virions, confirming its role as an envelope glycoprotein. Unlike HSV-1 gK, which is primarily perinuclear, VZV gK shows a more generalized distribution, suggesting different trafficking patterns between these related viruses. Additionally, using FLAG-tagged gK in recombinant VZV, researchers observed that gK accumulates predominantly in the Golgi apparatus while also being transported to the plasma membrane.

What is the role of gK in VZV replication and virion morphogenesis?

Studies using deletion mutants have demonstrated that gK is essential for VZV replication. When full or partial deletions were introduced in gK, viral replication was prevented when mutant cosmids were transfected into melanoma cells. The requirement for gK expression was further confirmed by restoring infectivity through insertion of the ORF5 sequence into a non-native site in the viral genome or by transfection into gK-complementing cell lines.

The generalized distribution of gK in infected cells, similar to other VZV glycoproteins, suggests that gK is accessible for incorporation into virions at sites beyond the perinuclear area. VZV gK could act as a chaperone protein during viral egress, based on its detection at multiple subcellular sites including the ER, Golgi, and cytoplasm.

What distinguishes VZV gK from its homologs in other alphaherpesviruses?

While gK is conserved among alphaherpesviruses, important functional differences exist. Notably, the insertion of HSV-1 gK into the endogenous VZV gK site did not compensate for the deletion of VZV gK, indicating that despite structural similarities, their biological functions differ significantly.

VZV gK, like HSV-1 gK, appears to have fusion inhibitory effects. Plaques were smaller and cytopathic changes were more limited when infectious virus was generated by transfecting gK-expressing cells with intact recombinant Oka strain or with gK deletion cosmids. Overexpression of VZV gK was associated with inhibition of the characteristic syncytium formation typically observed with VZV replication in tissue culture.

How does the lifecycle and stability of VZV gK compare to other viral glycoproteins?

Pulse-labeling experiments have revealed that the half-life of gK is considerably shorter than that of other VZV glycoproteins including gB, gE, and gH. This finding suggests that gK may be required in lower abundance than other viral glycoproteins during virion morphogenesis or viral entry.

Like several other herpesvirus glycoproteins, VZV gK is efficiently endocytosed from the plasma membrane. This recycling process may play a role in regulating the amount of gK present on the cell surface or in virions.

What techniques have been successful for detecting and studying VZV gK?

Due to the highly hydrophobic nature of VZV gK, producing specific antibodies has proven challenging. Researchers have successfully generated antibodies by creating a fusion protein of ORF5 codons 25 to 122 with glutathione S-transferase (GST). The resulting GSTgKN fusion protein was expressed in E. coli, purified, and used to raise polyclonal antibodies.

Another effective approach has been the insertion of epitope tags into the gK sequence. Researchers have inserted FLAG epitopes near the amino terminus of gK and produced VZV recombinants expressing epitope-tagged gK (VZV gK-F). These recombinants grew indistinguishably from native VZV, and the FLAG-tagged gK could be readily detected in infected cells.

What experimental systems have been developed to study gK function?

Several experimental systems have been developed to study VZV gK function:

  • Deletion mutants: A series of gK deletion mutants constructed with VZV cosmid DNA derived from the Oka strain have been used to study the requirement of gK for viral replication.

  • Complementing cell lines: gK-expressing cell lines have been developed to complement gK deletion mutants, allowing for the examination of gK function in trans.

  • Recombinant viruses with epitope-tagged gK: VZV recombinants expressing FLAG-tagged gK have enabled studies of gK localization and dynamics within infected cells.

  • Cross-species complementation: Experiments inserting HSV-1 gK into the VZV genome have examined the functional conservation and divergence between alphaherpesvirus gK proteins.

What are the critical functional domains of VZV gK that warrant further investigation?

The specific domains of gK required for VZV replication need further characterization through site-directed mutagenesis. Important questions remain about the functional domains responsible for viral entry, membrane fusion between infected and adjacent cells, and virion transport out of the infected cell.

The N-terminal and C-terminal domains, which are predicted to be extracellular, are of particular interest since deletions in these regions prevent viral replication. The relationship between gK structure and its various functions in the viral life cycle requires more detailed mapping.

How might targeting VZV gK contribute to antiviral strategies?

Given that gK is essential for VZV replication, it represents a potential target for antiviral therapies. Understanding the specific roles of gK in viral entry and egress could lead to the development of inhibitors that disrupt these processes. Additionally, since gK appears to regulate membrane fusion, which is essential for viral spread, targeting this function could limit virus dissemination in the host.

What technical innovations would advance VZV gK research?

The development of high-affinity antibodies against native gK remains challenging due to the protein's hydrophobic nature. Innovative approaches to generate such antibodies or alternative detection methods would significantly advance the field. Additionally, high-resolution structural analysis of gK, particularly through cryo-electron microscopy or X-ray crystallography, would provide valuable insights into its function and potential binding partners.

How does VZV gK contribute to viral pathogenesis in vivo?

While in vitro studies have established gK as essential for replication, its specific contributions to viral pathogenesis in vivo remain to be fully elucidated. Understanding how gK functions during VZV infection of human tissues, particularly in the context of both primary infection (chickenpox) and reactivation (herpes zoster), represents an important area for future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.