Recombinant Varicella-zoster virus Membrane protein 0 (ORF0)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Varicella-Zoster Virus Membrane Protein 0 (ORF0)

The Varicella-Zoster Virus (VZV), a member of the human herpesvirus family, is responsible for causing varicella (chickenpox) and zoster (shingles) . VZV establishes latency in sensory ganglia and can also lead to encephalomyelitis . The VZV genome comprises two unique regions, a unique long ( $$U_L$$ ) and a unique short ( $$U_S$$ ) region, each flanked by inverted repeats . During replication, the viral DNA can form four isomers based on the orientations of $$U_L$$ and $$U_S$$ .

ORF0, also known as ORFS/L, is an open reading frame (ORF) with an unknown function located at the extreme terminus of $$U_L$$, adjacent to the a-like sequences involved in viral DNA cleavage and packaging . Studies have shown that ORF0 is crucial for efficient viral replication and contains a sequence element involved in DNA cleavage .

Genetic Analysis and Function of ORF0

Genetic analyses using a novel luciferase VZV BAC system have shown that ORF0 is required for optimal viral growth . Deletion of ORF0 results in severely retarded growth both in vitro and in vivo, and the growth defects can be fully rescued by reintroducing wild-type copies of the gene into their native loci . This confirms that ORF0 is essential for efficient viral replication .

  • Role in Viral Replication: ORF0 plays a significant role in viral replication, as demonstrated by the growth defects observed in ORF0 deletion mutants .

  • Location and Structure: ORF0 is located at the terminus of the $$U_L$$ region of the VZV genome, adjacent to sequences involved in DNA cleavage and packaging .

ORF0 and Viral Attenuation

The attenuated genotype of VZV includes a mutation in ORF0 . Specifically, attenuated VZV strains like vOka, Ellen, and Suduvax contain the same stop codon mutation in ORF0 . This mutation is not found in other completely sequenced VZV genomes, suggesting that the ORF0 SNP is a determinant of attenuation .

  • Attenuation Mechanism: The ORF0 mutation is likely a key factor in the attenuation of VZV in vaccines .

  • Geographic Distribution: The presence of the same ORF0 mutation in geographically unrelated attenuated strains suggests a non-random event, reinforcing its role in attenuation .

Protein Characteristics and Localization

The ORF0 protein localizes to the Golgi network in infected and transfected cells . Deletion of the ORF0 gene is lethal, but retaining the N-terminal 28 amino acid residues results in a viable, yet replication-impaired virus .

  • Protein Localization: ORF0 protein is found in the Golgi network, indicating its potential involvement in protein processing or transport .

  • Functional Domains: The N-terminal region of ORF0 is critical for viral DNA cleavage and packaging, as demonstrated by the replication impairment observed when this region is retained .

Sialic Acids and Glycoprotein B (gB)

Sialic acids (SAs) on glycoprotein B (gB) are essential for the association with myelin-associated glycoprotein (MAG) and for membrane fusion during VZV infection . MAG mediates VZV infection by associating with gB, and the SAs on gB are required for membrane fusion and infection against MAG-expressing cells .

  • Role of Sialic Acids: SAs on gB are necessary for VZV membrane fusion, which is crucial for host cell entry .

  • MAG Interaction: The interaction between MAG and gB mediates membrane fusion during VZV infection, and this interaction is dependent on the presence of SAs on gB .

Experimental Techniques and Analysis

Various experimental techniques are employed to study ORF0, including:

  • PCR-based Mutagenesis: Used to generate VZV mutants with deletions in ORFs 0 to 4 .

  • Luciferase Assay: Utilized to monitor viral replication in vitro and in vivo, allowing for the quantification of viral growth kinetics .

  • Cell-Cell Fusion Assay: Used to analyze the SA-dependent recognition of gB by MAG and its involvement in membrane fusion .

  • Flow Cytometry: Employed to quantify the proportions of infected cells and analyze the expression levels of MAG on cell surfaces .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF0; Membrane protein 0; Membrane ORF0 protein; ORF S/L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Target Names
ORF0
Target Protein Sequence
MATVHYSRRPGTPPVTLTSSPGMDDVATPIPYLPTYAEAVADAPPPYRSRESLVFSPPLF PHVENGTTQQSYDCLDCAYDGIHRLQLAFLRIRKCCVPAFLILFGILTLTAVVVAIVAVF PEEPPNSTTRNYCPEGEGIYSRLQLVARVCTTKAIYVTKANVAIWSTTPSTLHNLSICIF SCADAFLRDRGLGTSTSGIRTAGGLARTTSGDALFCISSVC
Uniprot No.

Target Background

Protein Families
Varicellovirus ORF0 protein family
Subcellular Location
Host Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is ORF0 in Varicella-zoster virus and what is its significance?

ORF0, also known as ORFS/L, encodes a putative transmembrane protein in the VZV genome. It is homologous to the UL56 gene in Herpes Simplex Virus (HSV-1) . The protein has emerged as significant in virulence, as deletion studies have demonstrated that ORF0 is required for optimal viral growth both in vitro and in vivo . Most notably, ORF0 contains a stop codon mutation in attenuated VZV strains, including the vaccine Oka (vOka) strain and the highly attenuated Ellen strain, suggesting it plays a crucial role in viral attenuation . The protein may function in trafficking of virus within infected cells and potentially in viral replication processes .

Where is ORF0 located in the VZV genome and what are its structural characteristics?

ORF0 is located near the terminus of the VZV genome, spanning nucleotides 173-562, with a total size of 390 base pairs . It encodes a putative membrane protein that has been characterized as a potential virulence factor in VZV infection . While ORF0 is not essential for viral replication (unlike ORF4), its deletion results in significantly impaired viral growth, suggesting it has an important function in the viral life cycle . Structurally, the protein has been imaged in both two dimensions and three dimensions by confocal microscopy, though detailed structural analyses are still developing .

How does ORF0 function compare to homologs in other herpesviruses?

ORF0 is the homolog of the HSV-1 UL56 gene . Based on studies with the HSV-2 UL56 homolog, one property of this protein includes trafficking of virus within the infected cell . Unlike some other VZV genes, ORF0 does have homologs in other herpesviruses, distinguishing it from VZV-specific genes like ORF1 and ORF2 that lack HSV counterparts . The functional conservation of ORF0/UL56 across different herpesviruses suggests an evolutionarily important role, despite not being absolutely essential for viral replication in laboratory settings.

What are effective methods to generate VZV ORF0 mutants for functional studies?

Researchers have successfully employed bacterial artificial chromosome (BAC) systems to generate VZV ORF0 mutants. The procedure involves several key steps:

  • Insert a BAC vector into the VZV genome (typically the pOka strain)

  • Create a deletion construct where ORF0 is replaced with a selectable marker (e.g., kanamycin resistance cassette)

  • Use PCR-based mutagenesis with primers containing ~40-bp sequences homologous to flanking sequences of ORF0

  • Transform the construct into E. coli DY380 harboring VZV BAC DNA

  • Select for antibiotic-resistant colonies where homologous recombination has occurred

  • Confirm correct deletion by restriction enzyme digestion patterns and PCR analysis

  • Transfect the mutant BAC DNA into permissive cells (typically MeWo cells) to generate viral stocks

This approach allows for precise genetic manipulation and can be extended to creating rescue mutants by reinserting wild-type ORF0 sequences into the deletion mutant .

How can researchers quantify the effects of ORF0 mutations on viral growth?

Researchers have developed sophisticated methods to quantify the growth kinetics of VZV ORF0 mutants:

  • Luciferase-based assays: Creating a VZV strain carrying the luciferase gene (VZV Luc) enables real-time monitoring of viral growth through bioluminescence . This approach allows for:

    • Non-destructive monitoring of viral replication

    • Quantitative assessment in both in vitro and in vivo systems

    • Detection of subtle growth defects that might be missed by traditional methods

  • Infectious center assay: This traditional method involves counting visible plaques and provides complementary data to the bioluminescence approach .

  • Comparative analysis: Growth curves of wild-type, deletion mutant, and rescue mutant viruses should be generated in parallel to confirm that observed defects are specifically due to ORF0 deletion rather than other genomic changes .

Studies have shown that ORF0 deletion mutants display approximately 10-fold lower growth than wild-type virus, with significantly slower growth kinetics .

What in vitro and in vivo models are most appropriate for studying ORF0 function?

Based on the research literature, the following models have proven effective:

In vitro models:

  • MeWo cells (human melanoma cell line): The standard cell line for VZV propagation and functional studies

  • These cells support VZV replication and allow for quantitative measurement of growth defects in ORF0 mutants

In vivo models:

  • SCID-hu mouse model: Severe combined immunodeficient mice with human tissue xenografts

  • Particularly useful are:

    • T-cell xenografts: Allow assessment of T-cell tropism

    • Skin xenografts: Model VZV pathogenesis in human skin

  • This model permits analysis of virus replication in differentiated human tissues while avoiding issues with VZV's strict host specificity

The combined use of these models provides complementary data on ORF0 function in different contexts, revealing that ORF0 is important for optimal viral growth in both settings .

What is the proposed mechanism by which ORF0 contributes to viral virulence?

The exact mechanism by which ORF0 contributes to viral virulence remains under investigation, but several lines of evidence suggest potential mechanisms:

  • Viral trafficking: Based on studies of the HSV homolog UL56, ORF0 may be involved in trafficking of virus within infected cells . Disruption of this function could impair the efficiency of viral spread.

  • Cell adhesion modulation: ORF0 has been suggested to play a role in altering cell adhesion molecules in infected cells . This function could impact viral dissemination between cells and tissues.

  • Unknown regulatory functions: The significant growth defect observed with ORF0 deletion, both in vitro and in vivo, suggests it may have regulatory functions beyond what is currently understood .

  • Interaction with host factors: As a membrane protein, ORF0 may interact with host cell components to facilitate optimal viral replication and spread .

It's important to note that researchers have considered the possibility that deletion of ORF0 could interfere with end-of-genome functions rather than the specific function of the protein itself . This could be investigated by inserting stop codons in ORF0 rather than deleting the whole sequence.

How does the stop codon mutation in ORF0 contribute to viral attenuation in vaccine strains?

The stop codon mutation in ORF0 is a significant genetic determinant of attenuation in VZV vaccine strains. This same mutation is found in both the vOka vaccine strain and the highly attenuated Ellen strain . The probability of two VZV strains not connected by a recent common ancestor having an identical ORF0 SNP by chance would be 1 × 10^-8, which is extremely unlikely .

The mutation likely contributes to attenuation through:

  • Truncation of functional protein: The premature stop codon results in a truncated ORF0 protein that lacks full functionality .

  • Reduced virulence: The altered protein appears to reduce the virus's ability to replicate efficiently in human tissues, particularly skin .

  • Part of a broader attenuation signature: While ORF0 mutation is important, it works in concert with other genetic changes. The Ellen strain shows an ORF0 stop codon identical to vOka but lacks many other polymorphisms found in vOka .

This finding is particularly significant as it identifies a specific genetic determinant of attenuation in live VZV vaccines, which has implications for vaccine design and development.

What are the research challenges in studying ORF0 protein interactions?

Studying ORF0 protein interactions presents several significant challenges:

  • Membrane protein complexity: As a putative transmembrane protein, ORF0 presents difficulties for traditional protein interaction studies due to solubility issues and proper folding requirements .

  • Cell-associated nature of VZV: VZV is highly cell-associated, making isolation and purification of viral proteins during actual infection technically challenging .

  • Limited availability of specific tools: There may be limited availability of high-quality antibodies or other reagents specifically targeting ORF0.

  • Distinguishing direct from indirect effects: When phenotypes are observed in ORF0 mutants, it can be difficult to determine whether these are due to direct interactions or downstream effects .

  • Low abundance: As a regulatory protein, ORF0 may be present at relatively low levels in infected cells, making detection and interaction studies challenging.

These challenges have motivated the development of more sophisticated approaches, including the luciferase-tagged VZV BAC system, which allows for real-time monitoring of viral replication dynamics .

What controls should be included in ORF0 mutant experiments?

When designing experiments with ORF0 mutants, several essential controls should be included:

  • Wild-type VZV: Include the parental virus strain as a positive control for normal growth kinetics .

  • Rescue mutant: Generate an ORF0 rescue virus where the wild-type ORF0 sequence is reintroduced into the deletion mutant. This control confirms that observed phenotypes are specifically due to ORF0 deletion rather than unintended mutations elsewhere in the genome .

  • Other ORF deletion mutants: Include deletion mutants of other genes (like ORF1, ORF2, ORF3) as comparative controls to establish the relative importance of ORF0 .

  • Essential gene control: Include a known essential gene deletion (like ORF4) as a negative control for viral replication .

  • Multiple assay methods: Validate findings using different measurement techniques (e.g., both bioluminescence and infectious center assays) to ensure consistency of results .

The research by Zhang et al. demonstrated the importance of these controls by showing that growth defects in ORF0 deletion mutants could be fully rescued by reintroducing the wild-type gene, confirming the specificity of the observed phenotype .

What is the comparative function of ORF0 versus other proximal VZV genes?

Research has revealed distinct functional differences between ORF0 and other proximal genes in the VZV genome:

ORFLocationSize (bp)Gene productHSV-1 orthologueGrowth phenotypes
0173-562390Putative transmembrane proteinUL56Slow growth in vitro, slow growth in SCID-hu model
1589-915*327Putative transmembrane proteinNoneNormal growth in vitro and in vivo
21134-1850717UnknownNoneNormal growth in vitro and in vivo
31908-2447*540UnknownUL55Normal growth in vitro and in vivo
42783-4141*1,359Posttranscriptional regulatorUL54Essential for replication

*Encoded on the bottom strand

This comparative analysis demonstrates that among the first five ORFs of VZV:

  • ORF0 is required for optimal growth but not essential

  • ORF1, ORF2, and ORF3 are dispensable for viral replication both in vitro and in vivo

  • ORF4 is essential for viral replication

These functional differences highlight the unique role of ORF0 as a non-essential but significant contributor to viral virulence and growth efficiency .

How should researchers optimize transfection protocols for VZV ORF0 mutant BACs?

Optimizing transfection protocols for VZV BAC DNA is crucial for successful generation of ORF0 mutants:

  • Cell selection: MeWo cells are the preferred cell line for transfection of VZV BAC DNA due to their high permissiveness for VZV replication .

  • DNA preparation: BAC DNA should be prepared using endotoxin-free methods to ensure high quality and transfection efficiency .

  • Transfection method optimization:

    • Lipid-based transfection reagents often work well for BAC DNA

    • Consider nucleofection for higher efficiency with large BAC constructs

    • Optimize DNA:transfection reagent ratios empirically

  • Post-transfection monitoring: For ORF0 mutants, expect delayed plaque formation (plaques from ORF0 deletion mutants develop significantly slower than wild-type) .

  • Selection strategies: Consider using BACs with selectable markers to enrich for successfully transfected cells.

  • Co-cultivation approach: Once initial plaques are observed, co-cultivate infected cells with fresh uninfected cells to amplify the virus.

  • Verification of mutant virus: Confirm the genetic integrity of recovered viruses using PCR, sequencing, or restriction enzyme analysis to ensure no unwanted recombination has occurred during virus rescue .

These optimizations are particularly important for ORF0 mutants which show growth defects that could otherwise be interpreted as failed transfection .

What aspects of ORF0 function remain poorly understood?

Despite significant progress, several critical aspects of ORF0 function remain to be elucidated:

  • Molecular mechanism: The precise biochemical function of ORF0 protein remains unclear, including how it promotes efficient viral replication .

  • Protein interactions: The cellular and viral binding partners of ORF0 have not been comprehensively identified, limiting our understanding of its functional network .

  • Structural determinants of function: The relationship between ORF0 structure and function, particularly how the stop codon mutation disrupts activity, requires further investigation .

  • Tissue-specific effects: Whether ORF0 has differential effects in various human tissues and cell types beyond those tested in current models is unknown .

  • Temporal regulation: The expression kinetics of ORF0 during different phases of viral infection remains to be fully characterized.

  • Host response modulation: Whether ORF0 plays a role in modulating host immune responses has not been thoroughly investigated.

Addressing these knowledge gaps will require advanced approaches including proteomics, structural biology, and more sophisticated in vivo models that can capture the complexity of VZV pathogenesis .

How might novel technologies advance our understanding of ORF0?

Emerging technologies offer promising approaches to address current limitations in ORF0 research:

  • CRISPR-Cas9 genome editing: For more precise modifications of ORF0 in the viral genome, including introducing specific mutations rather than wholesale deletions .

  • Advanced imaging techniques: Super-resolution microscopy and live-cell imaging could reveal dynamic aspects of ORF0 localization and trafficking during infection .

  • Proximity labeling proteomics: Methods like BioID or APEX could identify proteins that interact with ORF0 in living cells during infection, providing insights into its functional networks.

  • Cryo-electron microscopy: Could potentially resolve the three-dimensional structure of ORF0 and its complexes at high resolution, informing structure-function relationships .

  • Single-cell approaches: Single-cell transcriptomics and proteomics could reveal cell-to-cell variability in ORF0 expression and function during infection.

  • Humanized mouse models: More sophisticated in vivo models could better recapitulate human VZV infection and the role of ORF0 in pathogenesis.

  • Combinatorial mutant analysis: Generating double or triple mutants involving ORF0 and other viral genes could reveal functional interactions and dependencies .

The luciferase VZV BAC system already represents a significant technological advancement for studying ORF0, enabling real-time monitoring of viral replication both in vitro and in vivo .

What implications does ORF0 research have for VZV vaccine development?

Research on ORF0 has significant implications for VZV vaccine development:

  • Attenuation mechanisms: The identification of the ORF0 stop codon mutation as a determinant of attenuation provides a specific genetic marker that could be incorporated into future vaccine designs .

  • Rational vaccine design: Understanding the precise contribution of ORF0 to attenuation could enable more rational approaches to creating live attenuated VZV vaccines with optimal safety and immunogenicity profiles .

  • Vaccine stability: Knowing that the ORF0 mutation is a key determinant of attenuation raises questions about the genetic stability of this mutation in vaccine strains during manufacturing and administration .

  • Correlates of protection: Investigating how ORF0 mutation affects the immune response could help identify correlates of protection for VZV vaccines.

  • Next-generation vaccines: This knowledge could inform the development of next-generation VZV vaccines that retain immunogenicity while eliminating residual virulence.

The extremely low probability (1 × 10^-8) of two unrelated VZV strains independently acquiring the same ORF0 mutation strongly suggests that this genetic change is a fundamental determinant of the attenuated phenotype, making it a prime target for vaccine research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.