Recombinant Varicella-zoster virus Ribonucleoside-diphosphate reductase small chain (ORF18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
RIR2; ORF18; Ribonucleoside-diphosphate reductase small subunit; Ribonucleotide reductase small subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Target Names
RIR2
Target Protein Sequence
MDQKDCSHFFYRPECPDINNLRALSISNRWLESDFIIEDDYQYLDCLTEDELIFYRFIFT FLSAADDLVNVNLGSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLMLFRGDESLRVQ YVNVTINNPSIQQKVQWLEEKVRDNPSVAEKYILMILIEGIFFVSSFAAIAYLRNNGLFV VTCQFNDLISRDEAIHTSASCCIYNNYVPEKPAITRIHQLFSEAVEIECAFLKSHAPKTR LVNVDAITQYVKFSADRLLSAINVPKLFNTPPPDSDFPLAFMIADKNTNFFERHSTSYAG TVINDL
Uniprot No.

Target Background

Function

Function: Recombinant Varicella-zoster virus Ribonucleoside-diphosphate reductase small chain (ORF18) is a subunit of the ribonucleoside-diphosphate reductase holoenzyme. This enzyme provides the deoxyribonucleotides essential for viral DNA synthesis. It facilitates viral replication in non-dividing cells and reactivation from latency in infected hosts. Its primary function is catalyzing the biosynthesis of deoxyribonucleotides from their corresponding ribonucleotides.

Protein Families
Ribonucleoside diphosphate reductase small chain family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

How does ORF18 compare to homologous proteins in other herpesviruses?

ORF18 belongs to a family of conserved proteins across herpesviruses, sharing structural and functional similarities with ribonucleotide reductase small subunits in herpes simplex virus (HSV) and other members of the herpesvirus family. While VZV has at least 70 genes with all but 6 having homologs in HSV, the ORF18 protein demonstrates both conserved and virus-specific domains.

Research approaches to conduct comparative analysis include:

  • Multiple sequence alignment of ribonucleotide reductase small subunits across herpesviruses

  • Phylogenetic analysis to establish evolutionary relationships

  • Domain mapping to identify conserved functional regions

  • Complementation studies to determine functional interchangeability

Unlike some essential VZV genes (ORF4, 5, 9, 21, 29, 62, and 68) that have been definitively shown to be required for growth in vitro, the essentiality of ORF18 for viral replication has not been as extensively characterized in the literature, providing an opportunity for further investigation .

What are the optimal expression systems for producing recombinant ORF18 protein for structural and functional studies?

The production of recombinant ORF18 protein requires careful consideration of expression systems to maintain proper folding and enzymatic activity. Based on research protocols for similar viral enzymes:

Bacterial Expression Systems:

  • E. coli BL21(DE3) with pET vectors containing affinity tags (His6, GST)

  • Optimization of induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (3-24 hours)

  • Supplementation with iron sources during expression

Eukaryotic Expression Systems:

  • Baculovirus-insect cell system for proper post-translational modifications

  • Mammalian cell expression (HEK293, CHO) for studies requiring authentic folding

  • Co-expression with the large subunit to facilitate complex formation

Purification Strategy:

  • Affinity chromatography using tag-based purification

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography to isolate monomeric or dimeric forms

  • Activity verification through enzyme assays

Researchers should note that storage conditions are critical: the protein is best maintained in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, with working aliquots recommended to be stored at 4°C for up to one week .

What methodologies are most effective for studying ORF18 in the context of VZV infection models?

Studying ORF18 in the context of VZV infection requires specialized approaches due to the cell-associated nature of VZV and its restricted host range. Effective methodologies include:

Recombinant Virus Construction:

  • Bacterial artificial chromosome (BAC) systems for generating recombinant VZV with modified ORF18

  • Cosmid-based recombination for gene deletions or modifications

  • CRISPR/Cas9 genome editing for precise modifications of ORF18

Infection Models:

  • Human skin xenografts in SCID mice for in vivo studies

  • Neuron-like SH-SY5Y cells for studying latency and reactivation

  • Human trigeminal ganglia explants for ex vivo analysis

Gene Expression Analysis:

  • Quantitative RT-PCR to measure ORF18 transcription kinetics

  • RNA-seq for transcriptome-wide effects of ORF18 manipulation

  • Fluorescent reporter fusions (similar to the ORF63-RFP and ORF11-GFP systems used for other VZV genes) to monitor expression dynamics

Functional Assessment:

  • Analysis of viral replication kinetics using plaque assays

  • Measurement of deoxyribonucleotide pools in infected cells

  • Inhibitor studies to determine the contribution of ORF18 to viral replication

A notable example methodology was demonstrated in studies of other VZV genes, where researchers employed a recombinant BAC VZV pOka strain expressing RFP fused to immediate early ORF63 and GFP fused to the leaky-late gene ORF11, allowing visualization of infection progression .

What is the role of ORF18 in VZV latency and reactivation?

The role of ORF18 in VZV latency and reactivation has not been as thoroughly characterized as other viral genes like VLT and ORF63, but methodological approaches to investigate this include:

Latency Models:

  • Neuron-like SH-SY5Y cell cultures treated with antiviral compounds (e.g., acyclovir) to establish quiescent infection

  • Differentiated human neurons derived from stem cells

  • Ex vivo human ganglia models

Gene Expression Analysis During Latency and Reactivation:

  • Single-cell RNA sequencing to detect low-level expression

  • Chromatin immunoprecipitation (ChIP) to analyze epigenetic regulation of the ORF18 promoter

  • In situ hybridization in latently infected ganglia

Functional Studies:

  • Overexpression of ORF18 in latently infected neurons to determine if it triggers reactivation

  • siRNA or CRISPR interference to suppress ORF18 expression during reactivation stimuli

  • Protein interaction studies to identify cellular partners involved in reactivation

Research on VZV latency has shown that during quiescent infection, limited viral gene expression occurs, with the VZV latency-associated transcript (VLT) and VLT-ORF63 splice variants being predominantly detected . The expression pattern of ORF18 during these phases could provide insights into its potential regulatory role during latency and reactivation.

How does ORF18 contribute to immune evasion strategies of VZV?

The contribution of ORF18 to VZV immune evasion has not been extensively characterized, but research methodologies to investigate this relationship include:

Immunological Assays:

  • T-cell recognition assays using ORF18 peptides

  • Antibody response profiling against recombinant ORF18

  • Cytokine production measurement in response to ORF18 expression

Immune Evasion Mechanisms:

  • Analysis of ORF18's effect on antigen presentation pathways

  • Investigation of interactions with innate immune sensors

  • Evaluation of impact on interferon signaling pathways

Comparative Studies:

  • Assessment of immune responses to wild-type versus ORF18-modified VZV

  • Cross-species analysis of immune recognition of ORF18 homologs

  • Temporal analysis of immune responses during primary infection versus reactivation

Understanding ORF18's role in immune evasion could have implications for vaccine development, as recombinant zoster vaccines have shown significant efficacy in reducing herpes zoster infection, even in immunocompromised populations (risk reduction of 81%, RR: 0.19, 95%CI: 0.09, 0.44) .

How can ORF18 be utilized in the development of novel antiviral strategies against VZV?

Developing novel antiviral strategies targeting ORF18 requires understanding its essential role in viral replication and identifying unique structural features that differentiate it from host enzymes. Research approaches include:

Drug Discovery Methodologies:

  • Structure-based virtual screening against ORF18 active site

  • Fragment-based lead discovery using NMR or X-ray crystallography

  • High-throughput screening of compound libraries against recombinant ORF18 enzymatic activity

Therapeutic Strategies:

  • Small molecule inhibitors specifically targeting viral ribonucleotide reductase

  • Peptide-based inhibitors disrupting the interaction between small and large subunits

  • Antisense oligonucleotides or siRNAs targeting ORF18 mRNA

Validation Approaches:

  • Enzyme inhibition assays using purified recombinant protein

  • Cell-based viral replication assays with candidate inhibitors

  • Resistance mutation analysis to identify binding sites

  • In vivo efficacy studies in humanized mouse models

The therapeutic potential of targeting ORF18 is supported by the success of nucleoside analogs that interfere with viral DNA replication. A systematic approach coupling structural biology with medicinal chemistry could yield selective inhibitors with fewer side effects than current antiviral treatments.

What is the potential for ORF18 modification in the development of next-generation VZV vaccines?

Modification of ORF18 presents intriguing possibilities for next-generation VZV vaccine development, building upon the success of current recombinant zoster vaccines. Research strategies include:

Attenuation Strategies:

  • Targeted mutations in ORF18 to reduce replicative capacity while maintaining immunogenicity

  • Conditional expression systems for controlled viral replication

  • Chimeric ORF18 constructs incorporating immunostimulatory epitopes

Vector Development:

  • Utilization of BAC-based systems to generate recombinant VZV with modified ORF18

  • Insertion of heterologous antigens into non-essential regions of ORF18

  • Development of ORF18-deficient viruses complemented in trans for single-cycle vaccines

Immunological Assessment:

  • Comparison of humoral and cell-mediated immune responses to wild-type versus modified ORF18

  • Durability of protection in animal models

  • Cross-protection against related herpesviruses

The potential of VZV as a vaccine vector has been recognized, with research showing that "VZV might be useful as a vaccine vector to immunize against both VZV and other viruses" . Recent studies on recombinant zoster vaccines have demonstrated not only protection against herpes zoster but also potential broader health benefits, including a significantly lower risk of dementia in the 6 years post-vaccination (RMTL ratio: 0.83, 95% CI: 0.79–0.87) .

What are the major challenges in expressing and purifying functional recombinant ORF18, and how can they be overcome?

Expression and purification of functional recombinant ORF18 present several technical challenges that researchers must address:

Challenge 1: Protein Solubility and Folding

  • Solution: Optimize expression conditions (temperature, inducer concentration)

  • Method: Test multiple fusion tags (MBP, SUMO, GST) to enhance solubility

  • Approach: Use specialized E. coli strains (Rosetta, Arctic Express) for improved folding

Challenge 2: Cofactor Incorporation

  • Solution: Supplement growth media with iron sources

  • Method: Reconstitute the iron-sulfur cluster in vitro after purification

  • Approach: Co-express with iron-sulfur cluster assembly proteins

Challenge 3: Maintaining Enzyme Activity

  • Solution: Implement oxygen-free purification techniques

  • Method: Include reducing agents (DTT, β-mercaptoethanol) in all buffers

  • Approach: Verify activity using coupled enzymatic assays after each purification step

Challenge 4: Protein Stability During Storage

  • Solution: Store in optimized buffer (Tris-based with 50% glycerol)

  • Method: Aliquot to avoid freeze-thaw cycles

  • Approach: Validate activity retention after storage at different temperatures and durations

A systematic approach combining multiple strategies tailored to the specific properties of ORF18 will yield higher success rates in obtaining functional protein for structural and biochemical studies.

How can researchers effectively study ORF18 function in the context of VZV latency, given the limitations of current in vitro models?

Studying ORF18 function during VZV latency presents significant challenges due to the limitations of current in vitro models. Innovative approaches to overcome these limitations include:

Challenge 1: Establishing Physiologically Relevant Latency Models

  • Solution: Develop improved neuronal models that better recapitulate human ganglia

  • Method: Use iPSC-derived sensory neurons cultured in compartmentalized chambers

  • Approach: Employ ex vivo human dorsal root ganglia with extended culture capabilities

Challenge 2: Detecting Low-Level ORF18 Expression During Latency

  • Solution: Implement highly sensitive detection methods

  • Method: Use digital droplet PCR for absolute quantification of rare transcripts

  • Approach: Apply single-cell RNA-seq to identify and characterize rare expressing cells

Challenge 3: Manipulating ORF18 Expression Without Disrupting Latency

  • Solution: Develop conditional expression/knockdown systems

  • Method: Use inducible CRISPR interference or activation systems

  • Approach: Apply optogenetic tools for temporal control of gene expression

Challenge 4: Distinguishing ORF18's Role from Other Viral Factors

  • Solution: Generate recombinant viruses with specific ORF18 modifications

  • Method: Employ complementation assays in trans to rescue phenotypes

  • Approach: Create reporter viruses similar to the v63R/11G construct described for other VZV genes

Recent advances in neuron-like SH-SY5Y cell models have shown promise for investigating VZV latency mechanisms, as demonstrated by studies of VZV gene expression repression during the establishment of latency .

What are the emerging technologies that could advance our understanding of ORF18's role in VZV biology?

Several cutting-edge technologies are poised to revolutionize our understanding of ORF18's role in VZV biology:

Cryo-Electron Microscopy:

  • High-resolution structural determination of ORF18 alone and in complex with the large subunit

  • Visualization of conformational changes during catalysis

  • Mapping of interaction interfaces with potential inhibitors

CRISPR/Cas Technologies:

  • Precise genome editing to create reporter fusions at the endogenous locus

  • CRISPRi/CRISPRa for temporal control of ORF18 expression

  • Base editing to introduce specific mutations without double-strand breaks

Single-Cell Approaches:

  • Single-cell RNA-seq to identify cell-specific responses to ORF18 expression

  • Spatial transcriptomics to map ORF18 expression patterns in infected tissues

  • Mass cytometry to profile cellular responses to ORF18 at the protein level

Organoid Models:

  • Skin organoids for studying VZV pathogenesis

  • Neural organoids for investigating latency and reactivation

  • Immune organoids for examining host-pathogen interactions

Computational Approaches:

  • Molecular dynamics simulations of ORF18 to identify druggable pockets

  • AI-driven prediction of ORF18 interactome

  • Systems biology modeling of ORF18's role in viral replication networks

These technologies could be particularly valuable when applied to understanding how ORF18 functions within the context of the entire viral genome, which contains at least 70 genes and has been manipulated through various recombinant approaches to study gene function .

How might ORF18 research contribute to our understanding of the potential link between VZV infection and neurological conditions?

Recent research has revealed intriguing associations between VZV infection, vaccination, and neurological conditions, presenting new avenues for investigating ORF18's potential role:

Epidemiological Approaches:

  • Case-control studies examining ORF18 sequence variations in patients with post-herpetic neuralgia

  • Longitudinal cohort studies tracking neurological outcomes in relation to ORF18 antibody responses

  • Registry-based studies comparing outcomes between wildtype and vaccine strain ORF18 exposure

Mechanistic Investigations:

  • Assessment of ORF18's impact on neuronal metabolism and function

  • Examination of potential neuroimmune interactions triggered by ORF18

  • Evaluation of ORF18's role in viral trafficking in neuronal axons

Translational Research:

  • Development of ORF18-based biomarkers for predicting neurological complications

  • Testing of ORF18-targeted interventions for preventing neurological sequelae

  • Investigation of ORF18 modifications in attenuated vaccine strains

A recent study demonstrated that recombinant zoster vaccination was associated with a significantly lower risk of dementia in the 6 years post-vaccination (RMTL ratio, 0.83; 95% CI, 0.79–0.87), suggesting potential neuroprotective effects of VZV vaccination . Understanding whether ORF18 contributes to these effects could provide valuable insights into both VZV pathogenesis and novel preventive strategies for neurological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.