Recombinant Varicella-zoster virus Structural protein 1 (ORF1)

Shipped with Ice Packs
In Stock

Description

Key Findings from ORF1 Deletion Mutants

ParameterORF1 Deletion MutantWild-Type VZV
In vitro growthSlight defect Optimal growth
In vivo replicationNo defect Normal replication
Protein expressionAbsent Detected in membrane

Recombinant viruses with epitope-tagged ORF1 confirmed its expression and membrane localization. These models demonstrated that ORF1 is not critical for viral replication but may influence secondary processes such as viral egress or host immune evasion .

Comparative Analysis of VZV Unique Genes

VZV encodes five genes absent in HSV-1, including ORF1. Below is a comparison of ORF1 with other unique VZV genes:

GeneFunction/LocalizationEssentialityKey InteractionsResearch Insights
ORF1Membrane protein, Golgi Dispensable UnknownPost-translational modification
ORF2Golgi network Dispensable UnknownRole in viral assembly hypothesized
ORF13Thymidylate synthetase UnknownORF6 (helicase-primase) Links nucleotide synthesis to DNA replication
ORF32Nuclear protein UnknownPhosphorylated by ORF47 Regulates nuclear processes
ORF57Tegument protein UnknownORF39, ORF9A (gN) Critical for virion assembly

Research Applications and Future Directions

Recombinant ORF1 has facilitated studies on:

  • Viral assembly: Epitope-tagged ORF1 enables tracking of membrane protein dynamics during virion formation .

  • Host interaction: Deletion mutants help elucidate ORF1’s potential role in modulating cellular membranes or immune evasion .

  • Vaccine development: While non-essential, ORF1’s structural role could inform strategies to engineer safer VZV vaccines .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
ORF1; Structural protein 1; Structural ORF1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Target Names
ORF1
Target Protein Sequence
MSRVSEYGVPEGVRESDSDTDSVFMYQHTELMQNNASPLVVQTRPPAVLIPLVDVPRPRS RRKASAQLKMQMDRLCNVLGVVLQMATLALVTYIAFVVHTRATSCKRE
Uniprot No.

Target Background

Protein Families
Varicellovirus ORF1 protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the molecular characterization of VZV ORF1?

VZV ORF1 encodes a protein of 108 amino acids, associated with a 470-base RNA transcript. The protein localizes to the membrane of VZV-infected cells and appears to undergo post-translational modification, as evidenced by the slightly larger size of the protein in infected cells compared to in vitro translated protein. Studies using recombinant viruses with epitope insertions have confirmed protein expression during infection, while experimental insertion of stop codons demonstrated that ORF1 is dispensable for virus growth in cell culture .

How can one generate recombinant VZV expressing modified ORF1?

Recombinant VZV expressing modified ORF1 can be generated using cosmid-based or BAC-based systems that contain overlapping fragments of the complete VZV genome. For epitope tagging, insertions can be made after the ninth codon of the ORF1 open reading frame, as previously demonstrated. The process involves:

  • Design and construction of cosmids/BACs with the desired ORF1 modification

  • Transfection of these constructs into susceptible cells

  • Recovery and verification of recombinant virus

  • Confirmation of proper expression using immunoprecipitation with antibodies against the inserted epitope

What expression systems are available for producing recombinant VZV ORF1 protein?

Several expression systems have been developed for VZV proteins that can be applied to ORF1:

  • Bacterial expression systems: Using BL21(DE3) or Rosetta DE3 cells with vectors encoding N-terminal 6×His tags, C-terminal 6×His tags, or N-terminal maltose-binding protein (MBP) tags under T7 promoter control

  • Baculovirus expression system: Subcloning ORF1 into DEST10 vectors providing N-terminal 6×His tags using Gateway recombinational cloning

  • Mammalian expression: Gateway recombinational cloning systems can be used to express ORF1 in mammalian cells

What methods can be used to detect VZV ORF1 expression?

Detection of VZV ORF1 expression can be accomplished through:

  • Western blotting: Using antibodies against epitope tags inserted into ORF1 or using specific anti-ORF1 monoclonal antibodies

  • Immunofluorescence: For subcellular localization studies in infected cells

  • Immunoprecipitation: To isolate and identify ORF1 and its potential binding partners

  • RNA analysis: Northern blotting or RT-PCR to detect the 470-base RNA transcript corresponding to ORF1

How does the membrane localization of ORF1 contribute to VZV pathogenesis?

While ORF1 is dispensable for in vitro growth, its membrane localization suggests potential roles in virus-host interactions that may be crucial in vivo. To investigate this:

  • Generate recombinant viruses: Create ORF1-null mutants and complemented viruses using cosmid or BAC technologies

  • In vitro membrane studies: Characterize interactions with host membrane proteins using co-immunoprecipitation and mass spectrometry

  • In vivo pathogenesis models: Utilize the SCIDhu mouse model with human skin xenografts to assess ORF1's role in skin tropism

  • T-cell tropism analysis: Determine if ORF1 affects VZV's ability to infect human T cells, which could impact viral dissemination

The SCIDhu mouse model is particularly valuable as it has previously demonstrated that other VZV mutants retain infectivity for human T cells in vitro and replicate efficiently in human skin, despite showing abnormal plaque phenotypes in cell culture .

What post-translational modifications occur in VZV ORF1 and how do they affect function?

Evidence suggests ORF1 undergoes post-translational modification in infected cells. To characterize these modifications:

  • Mass spectrometry analysis: Compare purified recombinant ORF1 expressed in bacteria versus virus-infected cells

  • Site-directed mutagenesis: Target potential modification sites and observe effects on protein localization and function

  • Inhibitor studies: Use specific inhibitors of protein modifications (phosphorylation, glycosylation, etc.) to determine which modifications occur

  • Temporal analysis: Examine modifications at different time points post-infection to correlate with virus replication cycle

How can structure-function analysis techniques be applied to VZV ORF1?

Although no crystal structure exists for ORF1, structure-function analysis can be approached through:

  • Homology modeling: While direct homology modeling may be challenging as ORF1 lacks HSV homologs, domains may be predicted using secondary structure prediction algorithms

  • Domain mapping: Create a series of truncation mutants to identify functional domains

  • Site-directed mutagenesis: Target conserved residues or predicted structural elements

  • Chimeric proteins: Replace domains with corresponding regions from related proteins to identify critical functional elements

This approach would mirror successful structure-function analyses performed for other VZV proteins like glycoprotein H, where specific domains were associated with viral tropism, entry, and fusion .

What is the role of ORF1 in virus assembly and egress?

As a membrane protein dispensable for in vitro growth, ORF1 might function in virus assembly or egress. Methodological approaches include:

  • Transmission electron microscopy: Compare ultrastructural details of wild-type versus ORF1-null viruses during assembly and egress

  • Live-cell imaging: Use fluorescently tagged ORF1 to track localization during the viral replication cycle

  • Immunogold labeling: Determine precise subcellular localization during virion formation

  • Proteomic analysis: Identify ORF1 interaction partners during different stages of viral morphogenesis

Can VZV ORF1 serve as a platform for developing novel recombinant vaccines?

Since ORF1 is dispensable for in vitro replication, its locus could potentially be used for inserting foreign antigens. Methodological considerations include:

  • Foreign antigen insertion: Replace or modify the ORF1 locus to express antigens from other pathogens

  • Expression optimization: Use strong promoters to enhance foreign antigen expression

  • Immunogenicity testing: Evaluate immune responses to the foreign antigens in appropriate models

  • Safety assessment: Ensure the recombinant virus maintains an acceptable safety profile

Previous studies have successfully created recombinant VZV expressing foreign viral genes from herpes simplex, Epstein-Barr virus, hepatitis B, mumps, HIV, and simian immunodeficiency virus, suggesting this approach may be viable for the ORF1 locus .

What cell culture systems are optimal for studying ORF1 function?

Different cell types offer unique advantages for recombinant VZV ORF1 studies:

Cell TypeAdvantagesApplications
MeWo (human melanoma)High susceptibility to VZV infectionViral growth kinetics, plaque morphology
ARPE-19 (retinal pigment epithelial)Support synchronous infectionTemporal expression studies
Human dermal fibroblastsPrimary cells relevant to pathogenesisViral tropism studies
Human T cellsStudy T cell tropismImmune cell interactions

For synchronous infection studies, recent advances in cell-free VZV preparation allowing titers up to 5×10^5 PFU per ml can be utilized for spin inoculation of ARPE-19 cells at controlled multiplicities of infection .

How can one resolve contradictory findings about ORF1 function between in vitro and in vivo systems?

Resolving contradictions between in vitro dispensability and potential in vivo importance requires:

  • Comparative models: Simultaneously test ORF1 mutants in multiple systems:

    • Cell culture (multiple cell types)

    • SCIDhu mouse model with human skin xenografts

    • Human tissue explants

  • Physiologically relevant conditions:

    • Vary culture conditions to mimic in vivo environments (temperature, oxygen levels)

    • Use organotypic 3D culture systems

    • Test under cellular stress conditions

  • Comprehensive readouts:

    • Beyond viral replication (immune response, viral spread, latency establishment)

    • Transcriptomic and proteomic comparisons between systems

    • Analysis of virus-host interactions

How can the cell-associated nature of VZV be overcome for recombinant ORF1 studies?

VZV's highly cell-associated growth presents challenges for studying recombinant viruses. Solutions include:

  • Cell-free virus preparation: Recent advances enable preparation of cell-free VZV with titers up to 5×10^5 PFU/ml

  • Synchronous infection protocols: Use spin inoculation of cell-free virus at controlled MOI (e.g., 0.12) to achieve temporal synchronization

  • Cosmid-based mutagenesis: Circumvent the need for homologous recombination in infected cells by using cosmid recombination in E. coli

  • BAC-based systems: Allow for stable maintenance and manipulation of the viral genome in bacteria before virus reconstitution

What are the optimal purification strategies for recombinant VZV ORF1 protein?

Purification strategies depend on the expression system used:

  • Bacterial expression:

    • For His-tagged constructs: Ni-NTA affinity chromatography under native or denaturing conditions

    • For MBP-tagged constructs: Amylose resin affinity purification

  • Baculovirus expression:

    • Insect cell lysis under mild conditions to preserve membrane protein structure

    • Detergent solubilization optimization (test panel of detergents)

    • Two-step purification combining affinity and size exclusion chromatography

  • From infected cells:

    • Immunoaffinity purification using epitope tags or specific antibodies

    • Membrane fractionation followed by detergent solubilization

How does ORF1 interact with host immune responses?

As a membrane protein unique to VZV, ORF1 may play roles in immune evasion or modulation:

  • Interactome studies: Identify host immune proteins that interact with ORF1

  • Immune cell response: Compare responses to wild-type versus ORF1-null viruses

  • Pattern recognition receptor modulation: Assess whether ORF1 affects innate immune sensing

  • MHC modulation: Determine if ORF1 alters antigen presentation

These studies are particularly relevant given that VZV has T cell tropism and elicits specific immune responses that differ from other herpesviruses .

Can ORF1 function be linked to VZV mitochondrial interactions?

Recent evidence indicates VZV regulates mitophagy to facilitate viral replication. To investigate potential ORF1 involvement:

  • Mitochondrial localization: Determine if ORF1 associates with mitochondria during infection

  • Interaction with mitophagy machinery: Test for physical or functional interactions with PINK1/Parkin pathways

  • Mitochondrial dynamics: Compare mitochondrial fission/fusion in the presence vs. absence of ORF1

  • Functional consequences: Measure mitochondrial function parameters in cells infected with wild-type vs. ORF1-null viruses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.