Recombinant Varicella-zoster virus Structural protein 1 (ORF1)

Shipped with Ice Packs
In Stock

Description

Table 1: Biochemical Properties of VZV ORF1

PropertyValue/DescriptionSource
Molecular mass12.1 kDa (calculated), 16–20 kDa (apparent)
LocalizationGolgi membranes, infected cell membranes
HSV-1 homologNone
FunctionMembrane dynamics, virion assembly

Functional Roles in Viral Replication

  • Membrane remodeling: May facilitate viral egress or secondary envelopment by interacting with other viral proteins .

  • Viral syncytium formation: Localizes to Golgi membranes, where syncytia form during infection .

Post-Translational Modifications and Interactions

ORF1 undergoes phosphorylation in infected cells, though the kinase responsible remains unidentified . Its interaction network includes:

  • Golgi-associated proteins: Co-localizes with components of the VZV DNA helicase-primase complex (ORF6, ORF52, ORF55) .

  • Tegument proteins: Potentially interacts with ORF57, a tegument protein involved in virion assembly .

Research Applications and Vaccine Development

ORF1’s non-essential nature makes it a candidate for genetic engineering in vaccine design:

  • Attenuated vaccines: Deletion of ORF1 could enhance safety without compromising replication .

  • Viral vectors: ORF1-deficient VZV may serve as a platform for delivering foreign antigens (e.g., HIV, HPV) .

Comparative Analysis with Other VZV Proteins

ORF1 is one of five VZV-specific genes absent in herpes simplex virus type 1 (HSV-1) . Unlike essential genes (e.g., ORF4, ORF62), ORF1’s dispensability highlights its specialized role in membrane dynamics rather than core replication processes .

Experimental Validation and Limitations

Key findings from mutagenesis studies:

  • Epitope tagging: Insertion of an 11-amino-acid epitope confirmed ORF1 expression and membrane localization .

  • Growth kinetics: ORF1-deficient viruses show no growth defects in vitro, but in vivo studies are lacking .

Future Research Directions

  • In vivo models: Assess ORF1’s role in latency and reactivation.

  • Protein interactions: Identify host or viral binding partners using mass spectrometry.

  • Therapeutic targeting: Explore ORF1 as a candidate for antiviral therapies in combination with other VZV proteins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Structural protein 1; Structural ORF1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Target Names
ORF1
Target Protein Sequence
MSRVSEYGVPEGVRESDSDTDSVFMYQHTELMQNNASPLVVRARPPAVLIPLVDVPRPRS RRKASAQLKMQMDRLCNVLGVVLQMATLALVTYIAFVVHTRATSCKRE
Uniprot No.

Target Background

Protein Families
Varicellovirus ORF1 protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the basic structure and size of the VZV ORF1 protein?

VZV ORF1 is predicted to encode a protein of 108 amino acids, derived from a 470-base RNA transcript. The protein localizes to the membrane of VZV-infected cells. Notably, the size of the ORF1 protein expressed in VZV-infected cells appears slightly larger than when translated in vitro, suggesting post-translational modifications occur during viral infection . The protein lacks homology to HSV-1 proteins, making it one of the unique proteins in the VZV proteome .

How does ORF1 contribute to the VZV genome organization?

The VZV genome contains at least 70 genes, with ORF1 being one of the six genes that lack homologs in herpes simplex virus . This uniqueness suggests that ORF1 may play a specialized role in VZV biology that differs from other herpesviruses, potentially contributing to VZV's distinct pathogenesis and clinical manifestations.

What techniques can be employed to study ORF1 function in laboratory settings?

Researchers can investigate ORF1 using recombinant virus technology. A valuable approach demonstrated in previous studies involves inserting epitope tags into the ORF1 coding sequence. For example, scientists have successfully inserted an 11-amino-acid epitope after the ninth codon of the ORF1 open reading frame, allowing for immunoprecipitation of the protein using monoclonal antibodies against the epitope . Additionally, researchers have created recombinant viruses with stop codons inserted before the epitope in the ORF1 gene to generate ORF1-deficient VZV for comparative studies .

How can one assess post-translational modifications of recombinant ORF1?

Comparative analysis of ORF1 expressed in infected cells versus in vitro translation systems can identify potential post-translational modifications. The observed size difference between these two conditions indicates modifications occurring in the cellular environment . Researchers should consider employing mass spectrometry analysis, phosphorylation-specific antibodies, or glycosylation detection assays to characterize these modifications more precisely.

Is ORF1 essential for VZV replication in vitro?

Experimental evidence indicates that ORF1 is dispensable for virus growth in cell culture. Studies using recombinant viruses with inserted stop codons that prevent ORF1 protein expression have demonstrated that these viruses are not growth-impaired in vitro . This finding suggests that while ORF1 may have important functions in specific aspects of VZV infection or in vivo pathogenesis, it is not critical for basic viral replication in laboratory cell cultures.

What potential roles might ORF1 play in VZV pathogenesis despite being non-essential for in vitro replication?

Although ORF1 is not required for growth in cell culture, its conservation in the VZV genome suggests functional importance in natural infections. The protein's membrane localization indicates potential roles in virus-host cell interactions, immune evasion, or specific tissue tropism that may not be apparent in standard cell culture systems . Research comparing the behavior of wild-type and ORF1-deficient viruses in more complex experimental systems, such as skin explant models or neuronal cultures, would provide valuable insights into its in vivo functions.

How does ORF1 reactivity differ between primary VZV infection and reactivation?

Serological studies have revealed that ORF1 shows a distinctive pattern of antibody reactivity that differs between primary infection and reactivation. Specifically, ORF1 appears to be reactive primarily with IgG antibodies from zoster (shingles) patients, suggesting its potential as a zoster marker candidate . This contrasts with other VZV proteins that may react with antibodies from both chickenpox and zoster patients.

What is the serological profile of ORF1 in different patient populations?

In healthy blood donor populations, ORF1 shows relatively low seroreactivity with approximately 7% of individuals demonstrating IgG antibodies against this protein . In contrast, during acute primary varicella infection, ORF1 typically does not react with IgG, IgA, or IgM antibodies at any time point in the course of infection . This serological profile differs significantly from other VZV proteins like ORF68 (glycoprotein E), which shows high seroreactivity (97% of healthy blood donors) and reacts with multiple antibody classes during primary infection .

How can recombinant ORF1 be utilized in developing improved VZV diagnostics?

The unique serological profile of ORF1, particularly its preferential reactivity with zoster sera, presents an opportunity for developing differential diagnostic assays that could distinguish between primary VZV infection and reactivation . Research should focus on optimizing expression systems for producing recombinant ORF1 with proper folding and post-translational modifications to ensure authentic antigenicity. Inclusion of ORF1 alongside other VZV antigens in multiplex serological assays could enhance diagnostic specificity.

What methodological approaches are recommended for studying ORF1 interactions with host cellular components?

To investigate ORF1's interactions with host cellular components, researchers should consider employing techniques such as co-immunoprecipitation with epitope-tagged ORF1, proximity ligation assays, or yeast two-hybrid screens. Given ORF1's membrane localization, membrane-specific interaction assays and lipid raft analysis may reveal important functional associations. Comparative proteomics between cells infected with wild-type VZV versus ORF1-deficient VZV could identify host pathways affected by this protein.

How does ORF1 contribute to the immunological footprint of VZV infection?

The serological data indicates that ORF1 may have a distinct immunological profile compared to other VZV proteins. While antibodies against ORF68 (gE) are nearly universal in VZV-exposed individuals (97% of healthy donors), antibodies against ORF1 are relatively rare (7% of healthy donors) . Furthermore, ORF1 appears to elicit antibody responses primarily during reactivation (zoster) rather than during primary infection (chickenpox) . This suggests that ORF1 may be differentially expressed or presented to the immune system during these distinct phases of infection.

What experimental design would best elucidate the kinetics of ORF1 expression during viral reactivation?

To study ORF1 expression during reactivation, researchers should consider using human neuron cultures derived from embryonic stem cells as demonstrated in recent VZV latency models . In this system, researchers could establish latent infection with recombinant VZV containing reportable markers linked to ORF1, then apply reactivation stimuli such as treatment with PI3K inhibitor LY294002 hydrochloride and phorbol ester PMA, combined with temperature shift to 33°C . Time-course analysis of ORF1 expression relative to immediate early, early, and late genes would provide valuable insights into its regulation during reactivation.

How does ORF1 compare functionally with other membrane-associated VZV proteins?

While ORF1 localizes to the membrane of infected cells, its function appears distinct from well-characterized VZV membrane proteins like glycoprotein E (gE, encoded by ORF68). Unlike gE, which is essential for viral replication and plays key roles in cell-to-cell spread and immune evasion, ORF1 is dispensable for in vitro replication . Additionally, while gE shows high seroreactivity and serves as a reliable marker for VZV exposure, ORF1's limited seroreactivity suggests either lower abundance, reduced immunogenicity, or expression limited to specific phases of infection .

What are the key methodological considerations when comparing multiple VZV proteins in functional studies?

When designing comparative studies of VZV proteins, researchers should carefully consider expression systems that maintain authentic post-translational modifications. For membrane proteins like ORF1, expression in mammalian systems is preferable to bacterial systems. Additionally, when creating recombinant viruses for functional studies, it's important to confirm that modifications to one gene don't inadvertently affect expression of other genes, especially for genes with overlapping reading frames or regulatory elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.