Recombinant Variola virus 36 kDa major membrane protein (C9L, F5L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
C9L; F5L; 36 kDa major membrane protein F5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-322
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
C9L
Target Protein Sequence
VEYDVDNNVQICTCANVSHINHTFWYYNNKVIALATEDRTSGYISSFIKRVNISLTCLNI SSLRYEDSGSYKGVSHLKDGVIVTTTMNISVKANIIDLTGRVCYLTRNYCEVKIRCEIKS FALNGSITPLHMILGTLDRWKYLPFPTDDYRYVGELKRYISGNPYPIESLALEISATFNR FTIVKNNDDEFSCYLFSQNYSFHKMLNARHICESEWEALNNNNDNSSSMPVSHNNRANDL SSMMSQLQNDNDDNNDYSAPMNINNLIMIVLITMLSIIIIIIVVIAIIAMYKRSKYSHID DN
Uniprot No.

Target Background

Database Links

KEGG: vg:1486389

Protein Families
Poxviridae F5 protein family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the Variola virus 36 kDa major membrane protein and what are its alternative designations?

The 36 kDa major membrane protein is a structural component of the Variola virus (smallpox virus). It is encoded by gene designations C9L or F5L, depending on the reference framework used. The protein has been isolated from the Variola virus strain India/Ind3/1967 (VARV) and has the UniProt accession number P33865 . The variation in nomenclature (C9L/F5L) appears in different poxvirus literature and reflects different gene mapping conventions, as evidenced by comparative genomic studies of orthopoxviruses .

How should researchers properly store and handle recombinant Variola virus 36 kDa major membrane protein?

For optimal preservation of protein activity and structure, the following methodological approach is recommended:

  • Long-term storage: Maintain at -20°C, or preferably at -80°C for extended periods

  • Working aliquots: Store at 4°C for up to one week only

  • Storage buffer: Utilize a Tris-based buffer with 50% glycerol optimized for protein stability

  • Handling protocol: Avoid repeated freeze-thaw cycles as they significantly degrade protein integrity

  • Aliquoting strategy: Upon initial thawing, divide into single-use aliquots before returning to storage

What experimental approaches are most effective for studying protein-protein interactions involving the 36 kDa major membrane protein?

When investigating interactions between the 36 kDa major membrane protein and host factors, researchers should implement a multi-modal approach:

  • Yeast two-hybrid screening: Useful for initial identification of potential interacting partners, but requires careful domain selection due to the membrane-associated nature of the protein

  • Co-immunoprecipitation with mass spectrometry: Provides validation of interactions in a more native context, though may require crosslinking approaches for membrane proteins

  • Proximity labeling techniques: BioID or APEX2 fusion constructs can identify proteins in close proximity within cellular contexts

  • Virus-host interactome mapping: Systematic approaches as outlined in viral-human protein interaction studies

This methodological framework allows researchers to map the protein's interactome while addressing the challenge of working with membrane proteins. Data integration from multiple methods significantly improves confidence in identified interactions.

How can researchers accurately distinguish between the roles of C9L/F5L and other related poxvirus membrane proteins in functional studies?

Distinguishing the specific functions of the 36 kDa major membrane protein from related proteins requires precise experimental design:

  • Comparative genomic analysis: Align orthologous genes across poxviruses to identify conserved and divergent domains. Note that in some poxvirus annotation systems, C9L corresponds to F3L (Kelch-like protein) while C11L corresponds to F5L (major membrane protein)

  • Domain-specific mutagenesis: Target conserved motifs unique to the 36 kDa protein to elucidate structure-function relationships

  • Complementation assays: Use recombinant viruses with specific gene knockouts followed by trans-complementation with wild-type or mutant proteins

  • Temporal expression analysis: Monitor expression timing during infection, as structural proteins often follow distinct expression patterns

  • Subcellular localization studies: Compare localization patterns with other membrane proteins using fluorescence microscopy or subcellular fractionation

This systematic approach helps delineate the unique contribution of the 36 kDa major membrane protein among the complex repertoire of poxvirus membrane proteins.

How should researchers interpret structural similarities between Variola virus 36 kDa major membrane protein and homologous proteins in other orthopoxviruses?

When analyzing structural homology between the Variola virus 36 kDa major membrane protein and related proteins in other orthopoxviruses, researchers should:

This analytical framework prevents overinterpretation of sequence similarities and provides context for functional conservation across the orthopoxvirus family.

What considerations are important when analyzing the membrane topology and post-translational modifications of the 36 kDa major membrane protein?

Accurate analysis of membrane topology and post-translational modifications requires:

  • Integrated prediction approaches: Combine multiple topology prediction algorithms (TMHMM, Phobius, TOPCONS) to generate consensus models of transmembrane regions

  • Experimental validation methods:

    • Protease protection assays

    • Site-directed glycosylation insertion

    • Cysteine accessibility methods

    • Epitope insertion with selective permeabilization microscopy

  • Mass spectrometry considerations:

    • Use specialized extraction protocols for hydrophobic membrane proteins

    • Employ multiple proteases beyond trypsin to increase coverage

    • Consider enrichment strategies for phosphorylated, glycosylated, or lipid-modified peptides

  • Structural context interpretation: The protein's function may depend on its position within the viral architecture; analysis should consider its potential role in the poxvirus core structure

This methodological framework addresses the specific challenges associated with membrane protein analysis that standard proteomic workflows often fail to adequately address.

How does the 36 kDa major membrane protein contribute to poxvirus core architecture and morphogenesis?

The contribution of the 36 kDa major membrane protein to poxvirus architecture should be examined through the lens of recent structural studies on poxvirus morphogenesis:

  • Structural integration analysis: The protein likely contributes to the viral core wall or palisade layer, similar to other major membrane proteins in poxviruses

  • Temporal expression correlation: Compare expression timing with known core assembly events during viral morphogenesis

  • Interaction mapping methodology:

    • Identify binding partners among other structural proteins

    • Determine if it interacts with components of the inner core wall or palisade layer

    • Assess potential interactions with viral DNA or core enzymes

  • Functional domains assessment:

    • Analyze the protein for potential oligomerization motifs

    • Identify conserved interaction domains across orthopoxviruses

    • Evaluate potential roles in membrane curvature or stabilization

Recent cryo-EM studies of poxvirus core structure have revealed that specific proteins form trimers that constitute architectural elements like the palisade layer . Researchers should consider whether the 36 kDa major membrane protein might play a similar structural role, potentially interacting with other proteins such as A4 that have been shown to be important for core integrity.

What are the methodological considerations for using recombinant Variola virus 36 kDa major membrane protein in protein-protein interaction studies?

When designing protein-protein interaction studies with this recombinant protein, researchers should consider:

  • Solubility enhancement strategies:

    • Truncation of transmembrane domains if appropriate

    • Fusion with solubility enhancement tags (MBP, SUMO, thioredoxin)

    • Use of detergent micelles or nanodiscs to maintain native conformation

    • Employ lipid reconstitution for functional assays

  • Interaction detection methodologies:

    • Surface plasmon resonance with captured liposomes or nanodiscs

    • Microscale thermophoresis for detecting interactions in solution

    • Bio-layer interferometry with oriented protein immobilization

    • Pull-down assays with appropriate controls for non-specific binding

  • Viral context considerations: Viral-host protein interactions often occur in specific cellular compartments or require additional viral factors . Experimental design should account for:

    • Potential requirements for other viral proteins

    • Cellular compartmentalization effects

    • Post-translational modifications that may occur during infection

This methodological framework addresses the specific challenges of working with recombinant membrane proteins while maintaining biological relevance.

How do orthologous proteins to the Variola virus 36 kDa major membrane protein compare across different poxviruses?

The following table summarizes key comparative data for orthologous proteins across selected poxviruses:

VirusGene DesignationProtein Length (aa)% Identity to VariolaFunction/AnnotationReference
Variola virusC9L/F5L322100%36 kDa major membrane protein
Monkeypox virusC11L34398.8%Major membrane protein (F5L)
Vaccinia virusF5L~340~98%Major membrane protein

Note: Researchers should be aware that some annotation systems list C9L as corresponding to F3L (Kelch-like protein) rather than F5L, which highlights the importance of careful sequence verification when working with orthopoxvirus proteins .

What are the most promising approaches for investigating the role of the 36 kDa major membrane protein in virus-host interactions?

To advance understanding of this protein's role in virus-host interactions, researchers should consider:

  • Cryo-electron microscopy approaches: Determine the protein's position within the viral architecture following methods similar to those used for other structural proteins

  • Interactome mapping strategies: Apply systematic approaches to identify host factors that interact with the protein during infection

  • Functional genomics methodologies:

    • CRISPR screening to identify host dependencies

    • Viral genetics with targeted mutations

    • Trans-complementation assays with heterologous expression systems

  • Structural biology integration: Combine structural predictions with experimental validation using techniques adapted for membrane proteins

This research roadmap capitalizes on advances in structural virology and virus-host interaction network analysis to address fundamental questions about this protein's role in the viral lifecycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.