Recombinant Variola virus Cell surface-binding protein (D8L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
D8L
Target Protein Sequence
MSQQLSPINIETKKAISNARLKPLNIHYNESKPTTIQNTGKLVRINFKGGYLSGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRTANTSAPFDSVFYLDNLLPSKLDYFKYLGTTINHSADA VWIIFPTPINIHSDQLSKFRTLLSLSNHEGKPHYITENYRNPYKLNDDTEVYYSGEIIRA ATTSPARENYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVYILTAILFLMSRRYSR EKQN
Uniprot No.

Q&A

What is the D8L protein and what is its role in orthopoxvirus infection?

D8L is an envelope protein of orthopoxviruses that binds to cell surface chondroitin sulfate during virus infection. It plays a critical role in the attachment of intracellular mature virions (IMV) to host cells. Studies have demonstrated that soluble D8L protein interferes with the adsorption of wild-type vaccinia virions to cells, indicating its direct involvement in virus entry . The protein has been identified as one of several viral attachment proteins that facilitate efficient binding to host cells, contributing significantly to virus infectivity.

How is recombinant D8L protein typically produced for research purposes?

Recombinant D8L protein is commonly produced through bacterial expression systems. Based on published protocols, researchers have successfully expressed D8L ectodomains in E. coli using different constructs:

  • D8 Δ262 (residues 1 to 261): The DNA fragment is amplified from vaccinia virus (strain Acam2000) genomic DNA using specific primers, restricted with NdeI and BamHI, and ligated into pET22b for cytosolic expression .

  • D8 Δ265 (residues 1 to 264): Amplified using different primers, digested with NcoI and XhoI, and cloned into pProEX-HTA .

Expression is typically induced with 1 mM IPTG at 37°C for 4 hours in CodonPlus BL21 cells, followed by purification through affinity chromatography and size exclusion chromatography to obtain pure, functional protein .

What structural features of D8L are important for its function?

D8L features a carbonic anhydrase (CAH) fold that has evolved specifically to bind to glycosaminoglycan (GAG) chondroitin sulfate (CS) on host cells. The protein contains a central positively charged crevice that serves as the CS binding site, as predicted by automated docking experiments .

The full-length D8 ectodomain forms a tetramer, although monomeric forms have been used for structural studies. When complexed with the LA5 antibody, D8 reveals an epitope formed by 23 discontinuous residues spread across 80% of the protein sequence. The antibody binds with a high-affinity lock-and-key mechanism above the CS-binding crevice, creating an unusually large antibody-antigen interface that buries 2,434 Ų of protein surface .

How does the binding affinity of antibodies against D8L compare to VIG for neutralization purposes?

Recent research has demonstrated that monoclonal antibodies (mAbs) targeting D8L exhibit superior neutralization capabilities compared to Vaccinia Immune Globulin (VIG). Several mAbs have been identified that recognize the D8 protein, including MV33 and MV49 .

MV33, which recognizes the D8 protein, demonstrates excellent affinity with a fast association rate of 2.1 × 10⁶, while its dissociation rate is extremely slow (below the detection limit of 1 × 10⁻⁷s⁻¹), placing its affinity in the sub-picomolar range . In neutralization assays, six mAbs exhibited effective mature virion (MV) neutralization capabilities superior to those of VIG .

Specifically, MV33 was found to be highly potent in blocking virus spread and comet formation even at low concentrations (full inhibition at 5 μg/mL and partial but substantial inhibition at 2.5 μg/mL), demonstrating greater effectiveness than VIG .

What is the impact of D8L expression on orthopoxvirus infectivity?

Research has shown that D8L plays a significant role in virus infectivity. Studies using mutant viruses with defective D8L gene expression demonstrate reduced relative infectivity compared to wild-type viruses. The following table illustrates the effect of D8L expression on virus infectivity:

VirusNo. of virion particles/fieldVirus titer (PFU/ml)Relative infectivity
Experiment 1
A27L + D8L +1366.7 × 10⁸1
A27L − D8L +314.8 × 10⁷0.31
A27L + D8L −2581.3 × 10⁸0.1
A27L − D8L −2839.3 × 10⁷0.066
Experiment 2
A27L + D8L +1361.8 × 10⁹1
A27L − D8L +209.6 × 10⁷0.36
A27L + D8L −2542.5 × 10⁸0.07
A27L − D8L −1101.5 × 10⁸0.10

When both A27L (another envelope protein) and D8L were defective, the relative infectivity dropped to approximately 0.066-0.10 compared to the wild-type virus . This indicates that D8L contributes significantly to efficient virus entry, though the virus can still infect cells through alternative mechanisms when D8L is absent.

How conserved is the D8L protein across different orthopoxvirus species?

Sequence alignment of various poxvirus D8 orthologs has revealed that the central crevice of D8L, which serves as the chondroitin sulfate binding site, is structurally conserved across orthopoxviruses . This conservation has significant implications for cross-protection strategies.

Recent research has demonstrated that monoclonal antibodies developed against vaccinia virus D8L were able to neutralize Mpox virus strains from both 2018 and 2022 outbreaks . These findings suggest that antibodies targeting conserved regions of D8L might provide cross-species protection against various orthopoxviruses, including variola virus (the causative agent of smallpox), vaccinia virus, and Mpox virus.

What methodologies are most effective for characterizing D8L-antibody interactions?

Several complementary techniques have proven effective for characterizing D8L-antibody interactions:

  • Crystallography: The crystal structure of the LA5 Fab-monomeric D8 complex has been determined at a resolution of 2.1 Å, as well as the unliganded structures of D8 and LA5-Fab at resolutions of 1.42 Å and 1.6 Å, respectively . This high-resolution structural analysis reveals detailed information about the binding interface.

  • Biolayer Interferometry (BLI): This technique has been used to determine the dissociation constant (Kd) values for antibodies exhibiting strong binding to D8 .

  • Surface Plasmon Resonance (SPR): For kinetic measurements, monomeric D8 Δ265 can be isolated by size exclusion chromatography in SPR running buffer and passed over antibody-immobilized sensor chips. Kinetic parameters can be calculated using a simple Langmuir 1:1 model .

  • ELISA: Both whole vaccinia virus ELISA and specificity-ELISA against major membrane proteins have been employed to identify antibody targets and characterize binding properties .

  • Linear Peptide ELISA: Biotinylated 20-mer peptides overlapping by 10 residues and covering the D8 protein sequence can be used to map linear epitopes recognized by antibodies .

How can recombinant D8L contribute to next-generation orthopoxvirus vaccines and therapeutics?

Recombinant D8L protein has significant potential for vaccine and therapeutic development:

  • Multiprotein Vaccination: D8 is an immunodominant antigen in the smallpox vaccine and has been used successfully, along with A27 and B5, in a multiprotein vaccination approach .

  • Monoclonal Antibody Therapy: Monoclonal antibodies targeting D8L have shown potent neutralization capabilities that exceed those of VIG. A panel of neutralizing monoclonal antibodies, recognizing diverse proteins of the vaccinia virus including D8, has been selected and characterized with high affinity and potent in vitro neutralization capabilities .

  • Cross-protection Against Multiple Orthopoxviruses: The cross-reactivity of anti-D8L antibodies against different orthopoxvirus species, including Mpox virus strains from 2018 and 2022 outbreaks, suggests potential for broad-spectrum protection .

  • Recombinant Alternative to VIG: Given the limitations of VIG (including batch-to-batch variability, poor efficiency, potential for transmitting blood-borne pathogens, and limited availability), recombinant monoclonal antibodies targeting D8L could serve as an unlimited, highly efficient, defined, and reproducible alternative .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.