Recombinant Variola virus Hemagglutinin (HA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Variola Virus Hemagglutinin (HA)

Recombinant Variola virus Hemagglutinin (HA) involves the expression of the hemagglutinin (HA) gene, typically from an influenza virus, within a Variola virus vector . The Variola virus, which causes smallpox, can be engineered to produce foreign proteins, such as HA from influenza viruses, by inserting the HA gene into the Variola virus genome . The hemagglutinin protein is a major surface glycoprotein of the influenza virus that is responsible for binding to host cells and initiating infection . Antibodies against HA neutralize the infectivity of the influenza virus, making it a key target for vaccine development .

Construction and Expression

The process begins with cloning the HA gene from an influenza subtype and inserting it into a Variola virus vector . The HA gene is placed under the control of a Variola virus promoter to ensure its expression in infected cells . Once the recombinant virus infects a cell, the HA gene is transcribed and translated, resulting in the production of the HA protein . The recombinant Variola virus is infectious and stable upon repeated passage in tissue culture cells .

Characteristics of Recombinant HA

The HA protein produced by the recombinant Variola virus exhibits similar characteristics to authentic influenza HA . It undergoes glycosylation and is transported to the cell surface, where it can be cleaved into HA1 and HA2 subunits . The glycosylation state of HA proteins can affect their antigenicity . HA proteins produced in mammalian cells, such as 293T or Expi293F cells, may induce higher HI antibody titers compared to those produced in insect cells .

Immunogenicity and Protection

Animals inoculated with recombinant Variola viruses expressing HA develop antibodies against influenza HA . In some instances, the antibody levels can be equivalent to or higher than those obtained after infection with live influenza virus . Recombinant HA influenza vaccines have demonstrated promising efficacy and safety in clinical trials, offering potentially broader-spectrum protection compared to traditional vaccines .

Applications in Vaccine Development

Recombinant Variola virus Hemagglutinin (HA) technology is primarily used for vaccine development against influenza and other viral diseases . A highly attenuated strain of vaccinia virus carrying an H5 hemagglutinin (HA)-encoding gene (rVV-H5 HA) can prevent severe histological outcomes in animal lungs .

Instability Concerns

The instability of the transgene in MVA-HANP as well as in recombinant progeny viruses from BHK-21 cells co-infected with MVA-HANP and CPXV-No-H1 has been previously reported . MVA-HANP and the recombinant viruses were genetically unstable and lost the transgene during cell culture passages . The instability of the transgene is one of the major concerns in the production of viral vector vaccines because any mutation in the expression cassette could lead to unpredicted characteristics .

Hemagglutination Inhibition (HI) Assay

The hemagglutination activity emphasizes the proper expression of the HA protein, which is functional and hemagglutinates the blood . The HA test here, is considered the basis of selection of the proper recombinant baculovirus carrying the hemagglutinating protein .

Examples of Research Findings

StudyFindings
PNAS, 1983 Demonstrated that a cDNA copy of the HA gene could be expressed in a vaccinia virus vector. Showed that the HA polypeptide was glycosylated and transported to the surface of the cell. Found that intradermal inoculation of experimental animals led to the production of circulating antibodies to HA.
Scientific Reports, 2016 Showed that a single immunization with a highly attenuated strain of vaccinia virus carrying an H5 hemagglutinin (HA)-encoding gene (rVV-H5 HA) was sufficient to prevent severe histological outcomes in animal lungs.
Frontiers in Microbiology, 2019 Indicated that a soluble recombinant HA protein mediates limited cross-protection against heterosubtypic influenza virus infection.
International Journal of Molecular Sciences, 2024 The HA test here, is considered the basis of selection of the proper recombinant baculovirus carrying the hemagglutinating protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
HA; A56R; J9R; Protein A56; Hemagglutinin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-313
Protein Length
Full Length of Mature Protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
HA
Target Protein Sequence
TPYPQTQISKKIGDDATLSCSRNNINDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDK ISYDSPYDDLVTTITIKSLTAKDAGTYVCAFFMTSTTNDTDKVDYEEYSTELIVNTDSES TIDIILSGSSHSPETSSEKPDYINNFNCSLVFEIATPGPITDNVENHTDTVTYTSDIINT VSTSSRESTTVKTSGPITNKEDHTVTDTVSYTTVSTSSEIVTTKSTANDAHNDNEPSTVS PTTVKNITKSIGKYSTKDYVKVFGIAALIILSAVAIFCITYYICNKRSRKYKTENKV
Uniprot No.

Target Background

Function
This protein prevents cell-to-cell fusion by interacting with and targeting the viral K2 protein on the host plasma membrane. The A56-K2 complex interacts with entry fusion complex (EFC) components, likely preventing superinfection and syncytium formation. Its interaction with the C3/VCP protein protects the infected cell and potentially the extracellular enveloped virus from complement attack.
Database Links

KEGG: vg:1486455

Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Component of the outermost membrane of EEV.

Q&A

What is the Variola virus Hemagglutinin gene and what is its significance in orthopoxvirus research?

The Hemagglutinin (HA) gene, also referred to as J7R in Variola virus, encodes a surface glycoprotein that mediates viral binding to host cells and plays a role in cell-to-cell spread. It is highly conserved among orthopoxviruses but contains species-specific regions that make it valuable for diagnostic assays. The HA gene has been extensively used as a target for the development of variola virus-specific detection methods, particularly in real-time PCR assays . Researchers utilize the conserved regions of the HA gene for pan-orthopoxvirus detection, while targeting non-homologous regions for variola-specific identification. The gene's sequence is well-characterized, with GenBank accession numbers like L22579 available as reference standards for laboratory work .

When designing experiments using the HA gene, researchers typically amplify it using primers targeting conserved flanking regions, with forward primers like 5'-TTG ATG AAC TCT TCG AGT TTC GAT-3' and reverse primers like 5'-CTA GAC TTT GTT TTC TGT TTT GTA T-3' . These amplified fragments can then be cloned into vectors for further study or used directly in detection assays.

How are recombinant Variola virus HA constructs used in diagnostic development?

Recombinant HA constructs serve as critical positive controls and reference materials for developing orthopoxvirus diagnostics without requiring intact variola virus. To develop such diagnostic tools, researchers typically clone the HA gene into standard vectors like pCR2.1-TOPO. This process begins with PCR amplification of the target gene from genomic DNA using high-fidelity polymerases, followed by gel isolation of the fragments, ligation into the vector, and transformation into competent cells .

The resulting clones are verified through sequencing with both vector-specific primers (such as T7 promoter and M13 reverse primers) and HA gene-specific sequencing primers (e.g., 5'-AGT GAC GTC TTG TAT TTT GAT-3' and 5'-TCT GTT TTG TAT TTA CGT G-3') . Once validated, these recombinant constructs can be used to optimize PCR assay conditions and determine limits of detection.

For real-time PCR assay development, researchers design TaqMan-MGB probes targeting specific regions of the HA gene. These assays typically involve optimizing primer and probe concentrations, MgCl₂ concentrations, and cycling conditions to achieve the lowest level of detection with the highest fluorescent signal-to-noise ratio . Validation is performed using both the cloned HA gene and genomic DNA purified from variola virus virions.

What biosafety considerations apply when working with recombinant Variola virus HA?

Working with recombinant Variola virus HA constructs requires strict adherence to biosafety protocols, though at a lower containment level than work with intact Variola virus. Since recombinant HA genes in standard vectors are non-infectious and cannot produce virions, they can typically be handled in BSL-2 laboratories, unlike intact Variola virus which requires maximum containment (BSL-4).

Researchers must follow institutional biosafety committee approvals and comply with select agent regulations when applicable. All waste containing recombinant Variola DNA should be properly decontaminated before disposal, typically through autoclaving or chemical treatment. Laboratory personnel must receive appropriate training in handling recombinant DNA and potentially hazardous biological materials.

When designing experiments that incorporate the HA gene into viral vectors (such as Modified Vaccinia virus Ankara, MVA), additional biosafety considerations emerge concerning the potential for recombination with naturally occurring orthopoxviruses. Studies have demonstrated that recombination can occur between MVA vectors expressing foreign genes (like influenza HA) and orthopoxviruses like cowpox virus, resulting in mosaic genomes with altered properties . These findings underscore the importance of careful risk assessment when developing recombinant orthopoxvirus-based vaccines or research tools.

What mechanisms drive recombination between orthopoxvirus HA genes, and how does this impact vaccine development?

Orthopoxvirus genomes, including those containing HA genes, can undergo recombination through a process of genetic exchange during co-infection or superinfection events in permissive or semi-permissive cells. This recombination typically occurs during DNA replication, as orthopoxviruses replicate in the cytoplasm of infected cells using virus-encoded machinery . The mechanism involves strand breakage, crossover, and repair between homologous sequences, resulting in genetic exchange between viral genomes.

Several factors influence recombination frequency:

  • Genomic homology between parental viruses

  • Cell type and permissiveness for viral replication

  • Timing of infection (co-infection versus superinfection)

  • Presence of genomic regions with structural instability

Research has demonstrated that recombination can occur even in settings previously considered unlikely. For example, studies with Modified Vaccinia virus Ankara carrying influenza HA and NP transgenes (MVA-HANP) co-infected with cowpox virus in semi-permissive Vero cells showed recombination despite the semi-permissive nature of the cells and superinfection exclusion mechanisms . This is particularly significant because viral DNA replication in non-permissive cells is not blocked, allowing recombination to occur even when viral replication is limited .

For vaccine development, these findings raise important concerns about the use of orthopoxvirus vectors expressing heterologous antigens like HA. Recombination events can lead to:

  • Transfer of transgenes from vaccine vectors to replication-competent orthopoxviruses

  • Acquisition of host range genes by attenuated vectors

  • Creation of mosaic genomes with unpredictable biological properties

  • Loss or modification of transgene expression cassettes

These potential outcomes necessitate careful characterization of recombinant vectors and comprehensive risk assessment before clinical application.

How can researchers detect and characterize genomic instability in recombinant HA expression systems?

Genomic instability in recombinant HA expression systems can be detected and characterized through several complementary approaches:

  • Serial Passage Analysis: Monitoring genetic stability through multiple passages in cell culture by periodically sequencing the transgene and flanking regions. Studies have demonstrated that MVA vectors expressing HA transgenes can lose portions of the expression cassette during passage, highlighting the need for stability testing .

  • Plaque Morphology Assessment: Recombinant viruses often display distinct plaque phenotypes. For example, recombinant viruses resulting from MVA-HANP and cowpox virus recombination showed plaque morphologies distinct from both parental viruses .

  • Whole Genome Sequencing: Next-generation sequencing provides comprehensive characterization of genomic alterations. This approach revealed that recombinant viruses from co-infection experiments contained mosaic genomes of different lengths, with some rescuing deleted genes from MVA and acquiring new host range genes .

  • PCR Analysis of Expression Cassettes: Targeted PCR can detect partial deletions or rearrangements in transgene expression cassettes. For instance, a non-HA-expressing recombinant virus (V-Rec1) was found to contain part of an expression cassette without the HA transgene, but retaining 94% of the NP transgene .

  • Functional Testing: Assessing expression of transgenes and biological properties of recombinant viruses to detect phenotypic changes associated with genomic instability.

A systematic approach might include initial plaque purification of virus isolates, followed by PCR screening for transgene presence, whole genome sequencing of selected isolates, and detailed analysis of insertion sites and genome structure. Bioinformatic analysis should focus on identifying recombination breakpoints, duplications, deletions, and gene fragments.

What role does the HA gene play in the evolution of orthopoxviruses as revealed by genomic analysis?

The HA gene provides important insights into orthopoxvirus evolution, particularly regarding gene duplication, transposition, and recombination events. Genomic analysis of historical smallpox vaccines and modern vaccinia strains reveals that the HA gene region has been subject to evolutionary processes that shaped the current diversity of orthopoxviruses.

Analysis of historical smallpox vaccines used in the United States between 1850 and 1902 demonstrated complex patterns of genetic changes, including gene duplication/transposition events that affected genomic regions containing HA orthologs . Sequence analysis of central conserved regions versus variable termini revealed that while core replication genes maintained high similarity (>99.47%), the variable regions containing genes like HA showed much lower identity (as low as 80.38%) .

The HA gene and other immunomodulatory genes are frequently located in the variable terminal regions of orthopoxvirus genomes, which harbor genes involved in host range, immunomodulation, and virulence. Comparative genomic analysis revealed that some orthopoxvirus strains underwent duplication/transposition events that moved gene sequences between the right and left genomic termini . For example, VACV C11R (an ortholog encoding epidermal growth factor) was duplicated and transposed from the left end to the right end in some VACV strains, making them diploid for important accessory genes .

Researchers studying orthopoxvirus evolution should employ multiple analytical approaches:

  • Whole genome alignment to identify SNPs and INDELs

  • Phylogenetic analysis of core genes

  • Analysis of genomic rearrangements, duplications, and transpositions

  • Detailed examination of terminal variable regions

These approaches allow for a more comprehensive understanding of evolutionary relationships than simple phylogenetic trees, which may obscure important genomic features like duplications, translocations, and recombination events in microregions of virus genomes .

What methodological approaches are most effective for developing specific detection assays for Variola virus HA versus other orthopoxvirus HA variants?

Developing highly specific detection assays for Variola virus HA versus other orthopoxvirus HA variants requires strategic approaches that exploit sequence differences while maintaining sensitivity. The most effective methodological framework involves:

  • Comprehensive Sequence Alignment: Collect and align multiple HA gene sequences from diverse orthopoxviruses to identify regions of homology and variation. Effective assay design should be based on alignments of numerous sequences (e.g., researchers have used alignments of 28 HA genes including 12 variola virus, 7 vaccinia virus, and 11 non-variola virus genes) .

  • Strategic Target Selection: Conserved regions should be targeted for pan-orthopoxvirus detection, while unique regions should be targeted for variola-specific detection. The J7R (HA) gene has proven effective as a target for variola virus-specific detection .

  • Primer and Probe Design: For real-time PCR assays, design primers flanking the region of interest and TaqMan-MGB probes targeting the specific sequence. The use of Minor Groove Binder (MGB) probes increases the binding stability and allows for shorter probe sequences, enhancing specificity .

  • Optimization Protocol:

    • Test multiple primer concentrations (typically 0.1 to 0.9 μM)

    • Optimize MgCl₂ concentration

    • Evaluate various probe concentrations

    • Determine optimal cycling conditions

    • Select conditions providing the lowest level of detection, lowest Ct value, and highest fluorescent signal-to-noise ratio

  • Validation Against Diverse Panels: Test assays against panels of orthopoxvirus DNA, including:

    • Cloned gene fragments from multiple species

    • Genomic DNA purified from virions

    • Clinical or environmental samples

For quantitative assays, standard curves should be constructed using serial dilutions of both cloned genes and genomic DNA. The limit of detection (LOD) should be determined as the gene copy number detected 100% of the time .

This methodological framework has been successfully applied to develop assays that can distinguish variola virus from other orthopoxviruses, including vaccine strains like vaccinia virus Ankara .

How does recombination between Variola virus HA and other orthopoxvirus HA genes impact biosafety risk assessment for vaccine vectors?

Recombination between Variola virus HA and other orthopoxvirus HA genes represents a significant biosafety concern that requires comprehensive risk assessment. Research has demonstrated that recombination can occur between attenuated vaccine vectors like MVA expressing heterologous genes and naturally circulating orthopoxviruses, with several implications for biosafety:

  • Creation of Novel Phenotypes: Recombination between MVA vectors and orthopoxviruses can produce recombinant viruses with mosaic genomes and unpredictable biological properties. Experimental evidence shows that co-infection or superinfection of MVA-HANP with cowpox virus in Vero cells resulted in recombinant viruses with distinct plaque morphologies and genetic compositions .

  • Rescue of Deleted Genes: MVA has multiple genomic deletions that contribute to its attenuation. Recombination can potentially restore these deleted regions, as demonstrated when recombinant viruses with genomes similar to MVA-HANP (>50%) rescued deleted and/or fragmented genes and gained new host range genes .

  • Transfer of Transgenes: The transfer of transgenes from vaccine vectors to replication-competent orthopoxviruses is a significant concern. Studies have shown that influenza HA and NP transgenes can be transferred to recombinant viruses with genomes primarily derived from cowpox virus .

  • Transgene Instability: The stability of transgene expression cassettes is another critical factor. Research has shown that MVA-HANP can contain partially deleted transgene expression cassettes, which can be transferred to recombinant progeny viruses .

Risk assessment should consider:

  • Cell types used for vaccine production and their permissiveness for MVA replication

  • Potential for co-circulation with naturally occurring orthopoxviruses in target populations

  • Stability of transgene expression cassettes during manufacturing and storage

  • Biological characterization of potential recombinants: host range, replication capacity, cell tropism, transmissibility, and virulence

The evidence from experimental recombination studies demonstrates that even in semi-permissive cells with superinfection exclusion mechanisms, recombination can occur and produce viruses with altered genetic and phenotypic properties . This highlights the need for thorough safety evaluation and monitoring of orthopoxvirus-based vaccine vectors, especially those expressing heterologous antigens like HA.

What optimization strategies are recommended for cloning and expressing Variola virus HA in research settings?

Optimizing the cloning and expression of Variola virus HA requires attention to several methodological considerations:

  • Gene Amplification Strategy: For initial cloning, researchers typically amplify the HA gene using high-fidelity polymerases and primers targeting conserved flanking regions. Successful amplification has been achieved using forward primers like 5'-TTG ATG AAC TCT TCG AGT TTC GAT-3' and reverse primers like 5'-CTA GAC TTT GTT TTC TGT TTT GTA T-3' .

  • Vector Selection: The pCR2.1-TOPO vector has been successfully used for cloning HA gene fragments . For expression studies, vectors with strong promoters appropriate for the expression system (bacterial, yeast, insect, or mammalian) should be selected.

  • Sequence Verification Protocol:

    • Sequence with vector-specific primers (e.g., T7 promoter, M13 reverse)

    • Use gene-specific internal sequencing primers for complete coverage (e.g., 5'-AGT GAC GTC TTG TAT TTT GAT-3' and 5'-TCT GTT TTG TAT TTA CGT G-3')

    • Assemble and analyze sequence data using software like SeqMan II (DNASTAR)

    • Compare to reference sequences to confirm accuracy

  • Expression System Considerations:

    • Bacterial systems (E. coli): Use for protein production for structural studies or antibody generation

    • Mammalian systems: Preferred for functional studies requiring proper glycosylation

    • Viral vectors (e.g., MVA): Use for vaccine development, but with awareness of recombination risks

  • Codon Optimization: For improved expression in heterologous systems, codon optimization based on the preferred codon usage of the expression host may enhance protein yields.

When working with HA in viral vector systems, additional considerations include ensuring the stability of the expression cassette during passage, as studies have demonstrated that transgene instability can occur in MVA vectors expressing HA . Regular sequencing of the expression cassette during passage is recommended to monitor potential deletions or rearrangements.

What technical challenges exist in studying recombination between orthopoxvirus HA genes, and how can they be addressed?

Studying recombination between orthopoxvirus HA genes presents several technical challenges that require specialized methodological approaches:

  • Detection of Rare Recombination Events:

    • Challenge: Recombination events may occur at low frequency, especially in semi-permissive systems.

    • Solution: Use selection markers flanking the HA gene or implement screening strategies such as plaque purification followed by PCR analysis or fluorescence-based selection systems .

  • Distinguishing Natural Variation from Recombination:

    • Challenge: Differentiating between point mutations and true recombination events.

    • Solution: Implement whole genome sequencing and sophisticated bioinformatic analysis to identify recombination breakpoints. Analysis should focus on identifying mosaic genome structures rather than relying solely on SNP detection .

  • Biosafety Considerations:

    • Challenge: Safely studying recombination involving attenuated and virulent orthopoxviruses.

    • Solution: Conduct experiments in appropriate biocontainment facilities, use attenuated strains where possible, and implement strategies to prevent the release of recombinant viruses .

  • Experimental Design for Co-infection and Superinfection:

    • Challenge: Controlling the timing and multiplicity of infection to study superinfection exclusion and its impact on recombination.

    • Solution: Establish precise infection protocols with time gaps between primary and secondary infections (e.g., 4h and 6h post-primary infection have been shown to produce 90% and 99% exclusion of superinfecting virus, respectively) .

  • Characterization of Recombinant Progeny:

    • Challenge: Comprehensive phenotypic and genotypic characterization of recombinant viruses.

    • Solution: Implement a systematic approach including:

      • Plaque morphology assessment

      • PCR screening for transgene presence and organization

      • Whole genome sequencing

      • Biological characterization (host range, replication capacity, cell tropism)

      • Transmissibility and virulence testing in appropriate models

  • Transgene Stability Assessment:

    • Challenge: Monitoring the stability of transgene expression cassettes.

    • Solution: Implement serial passage experiments with regular screening by PCR and sequencing to detect deletions or rearrangements in the expression cassette .

By addressing these technical challenges through rigorous experimental design and comprehensive analysis, researchers can gain valuable insights into the mechanisms and consequences of recombination between orthopoxvirus HA genes, which is critical for biosafety risk assessment of orthopoxvirus-based vaccines and research tools.

How can comparative genomic analysis of orthopoxvirus HA genes inform our understanding of viral evolution and host adaptation?

Comparative genomic analysis of orthopoxvirus HA genes provides a powerful approach for understanding viral evolution and host adaptation. The HA gene is particularly informative because it plays a role in host cell binding and is subject to selection pressures related to host range.

Analysis of historical smallpox vaccines used between 1850 and 1902 has revealed complex patterns of gene duplication, transposition, fragmentation, and loss that shaped the evolution of modern vaccinia virus strains . The variable terminal regions of orthopoxvirus genomes, which contain genes like HA involved in host interactions, show substantially lower sequence identity (as low as 80.38%) compared to the highly conserved central regions (>99.47% identity) .

Emerging approaches for comparative HA gene analysis include:

  • Whole Genome Synteny Analysis: Examining the genomic context of HA genes reveals evolutionary events such as the duplication/transposition of gene blocks. For example, some VACV strains underwent duplication events that made them diploid for important accessory genes like VACV C11R (encoding epidermal growth factor) .

  • Recombination Detection Programs: Specialized algorithms can identify potential recombination breakpoints and mosaic genome structures, revealing the role of genetic exchange in HA gene evolution.

  • Selection Pressure Analysis: Calculating dN/dS ratios across the HA gene can identify regions under positive selection, which may correlate with host adaptation.

  • Structural Modeling: Mapping sequence variations onto predicted protein structures can provide insights into functional implications of evolutionary changes.

These approaches can reveal how orthopoxvirus HA genes evolve in response to different hosts, with implications for understanding emerging orthopoxvirus threats and developing targeted countermeasures. The analysis of historical vaccine strains suggests that modern VACV strains likely evolved from viruses related to VK and MFDV_1902 vaccines, which coexisted with ancient horsepox virus-based vaccines .

What implications do our current understanding of orthopoxvirus HA recombination have for future vaccine development strategies?

The current understanding of orthopoxvirus HA recombination has significant implications for future vaccine development strategies, particularly for vector-based vaccines:

  • Vector Design Considerations:

    • Increasing transgene stability through optimized design of expression cassettes

    • Placing transgenes in genomic locations less prone to recombination

    • Implementing additional attenuation strategies that are not easily reversed by recombination

    • Considering non-orthopoxvirus vectors for areas where orthopoxviruses are endemic

  • Safety Monitoring Strategies:

    • Developing molecular assays to detect potential recombination events

    • Implementing surveillance programs in areas where recombinant vaccines are deployed

    • Establishing bioinformatic pipelines to analyze field isolates for evidence of recombination

  • Novel Approaches to Minimize Recombination Risk:

    • Exploring non-homologous recombination systems

    • Developing vectors with reduced sequence homology to naturally circulating orthopoxviruses

    • Investigating synthetic biology approaches to create orthogonal genetic systems

The research has demonstrated that recombination can occur in semi-permissive cells like Vero despite mechanisms like superinfection exclusion . This challenges previous assumptions about the safety of attenuated vectors and emphasizes the need for comprehensive risk assessment.

Future vaccine development should incorporate careful transgene design and selection, as studies have shown that transgene instability is a significant concern. MVA-HANP has been observed to lose the transgene during cell culture passages, and similar instability has been observed in recombinant progeny viruses .

The potential transfer of transgenes to replication-competent orthopoxviruses represents a particularly significant risk that must be addressed in future vector design . Strategies might include implementing biological containment through the use of viral vectors that cannot complete their lifecycle in the presence of wild-type viruses or developing built-in mechanisms to eliminate recombinant progeny.

How might advanced molecular techniques enhance our ability to detect and characterize Variola virus HA for biodefense applications?

Advanced molecular techniques offer promising approaches to enhance detection and characterization of Variola virus HA for biodefense applications:

  • Digital PCR Technologies:

    • Provides absolute quantification without requiring standard curves

    • Offers enhanced sensitivity and precision for detecting low copy numbers

    • Reduces susceptibility to inhibitors present in complex sample matrices

  • CRISPR-Cas Diagnostic Systems:

    • CRISPR-based detection methods such as SHERLOCK or DETECTR can be designed to target specific sequences in the variola HA gene

    • Offers rapid detection with single-base specificity and potential for field deployment

    • Can be coupled with isothermal amplification for enhanced sensitivity

  • Nanopore Sequencing:

    • Enables real-time, long-read sequencing of HA genes directly from samples

    • Allows detection of structural variations and recombination events

    • Potential for field deployment in portable sequencing devices

  • Multiplex Detection Platforms:

    • Simultaneous detection of multiple orthopoxvirus targets including HA

    • Integration with syndromic panels for differential diagnosis of febrile rash illnesses

    • Implementation on high-throughput platforms for surveillance applications

  • Machine Learning Approaches:

    • Development of algorithms to distinguish variola HA signatures from other orthopoxviruses

    • Pattern recognition for identifying recombinant or engineered sequences

    • Automated analysis of sequence data for rapid threat assessment

Current real-time PCR assays targeting the HA (J7R) gene have demonstrated effectiveness for variola virus detection . These assays use TaqMan-MGB probes targeting specific regions of the HA gene, with optimized primer and probe concentrations to achieve the lowest level of detection and highest fluorescent signal-to-noise ratio .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.