Recombinant Variola virus Late protein H2 (H2R, I2R)

Shipped with Ice Packs
In Stock

Description

General Information

  • Role in Viral Entry H2 is required for the fusion of the viral and cell membranes during cell entry . It interacts directly with another protein, A28, and enhances the amount of neutralizing antibody that reacts with A28 .

  • Late Gene Expression The gene encoding H3 is a late gene in the MV virus .

  • Orthopoxvirus Genus Variola virus, the most virulent member of the Orthopoxvirus genus, exclusively infects humans and has no animal reservoir .

Interaction with A28 Protein

  • Enhancement of Neutralizing Antibody Response The neutralizing antibody response to the vaccinia virus A28 protein is enhanced by its association with the H2 protein .

  • Stabilization of A28 Conformation The interaction between H2 and A28 can stabilize the conformation of A28 on the virus surface . This is important for the epitope recognized by the anti-A28 antibody, which is mainly located at the C-terminal of A28 .

  • Antibody Titers Simultaneous immunization of A28 and H2 genes results in higher antibody titers and stronger neutralizing activity in vitro and in vivo compared to single immunization with either A28 or H2 .

H3 Protein

  • H3-deficient Virus An H3-deficient virus had a smaller plaque size, a virulence one tenth that of the wild-type virus, and a modified morphology .

  • Role in Virus Infection The H3 protein is related to virus infection, and the toxicity of H3-deficient virus in vivo is reduced .

  • Role in Assembly of Virus Particles The H3 protein plays a role in the assembly of virus particles .

  • Antibodies H3-specific antibodies are detectable in most people vaccinated with the Dryvax vaccine, especially after a second vaccination .

Variola Proteins for Research

  • Research Tools Variola proteins are novel and unique probes of the human immune system .

  • Targets These targets include cytokines, growth factors, complement, apoptosis, and various immune cell functions .

  • Anti-Immune Proteins A substantial number of these viral proteins are targeted to inhibit human immune molecules, some of which undoubtedly remain to be identified . Thus, the expressed variola proteins collectively represent an untapped resource of experimental probes with which it may be possible to identify and characterize new and potentially still-unknown human immune system components .

Table of Variola Virus Proteins as Targets of Protective Immunity

ProteinFunction
A17MV membrane-associated protein; target of neutralizing antibodies
A27MV membrane-associated protein; involved in attachment of MVs; target of neutralizing antibodies
A28MV membrane-associated protein; required for fusion of the viral and cell membranes; target of neutralizing antibodies
D8MV membrane-associated protein; involved in attachment of MVs; target of neutralizing antibodies
H2Required for fusion; interacts directly with A28 and greatly increases the amount of neutralizing antibody that reacts with A28
H3MV membrane-associated protein; involved in attachment of MVs; target of neutralizing antibodies
L1MV membrane-associated protein; required for fusion of the viral and cell membranes; target of neutralizing antibodies
SPICESPICE functions more like factor H, which serves as a cofactor for factor I in the degradation of iC3b 2 to C3c/C3dg after longer incubations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To request a specific tag, please indicate this in your order; we will prioritize fulfilling specified tag requests.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
H2R
Target Protein Sequence
MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELT RYMRIKNTVNDWKSLTDSKTKLESDRGRLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYL PQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPH WCSDLSNME
Uniprot No.

Q&A

What is the structural characterization of Variola virus Late protein H2 compared to other viral proteins like H7R?

The Variola virus Late protein H2 (H2R, I2R) belongs to the same class of late proteins as H7R but differs in amino acid sequence and potentially in function. Based on comparative analysis with proteins like H7R (146 amino acids), H2R is likely expressed during the late stage of viral replication. Similar to H7R, which has been successfully expressed with an N-terminal His tag in E. coli expression systems, H2R can be approached with similar recombinant protein expression strategies . Researchers should note that structural determination would require purification of the recombinant protein followed by X-ray crystallography or cryo-electron microscopy studies.

How does Variola virus Late protein H2 contribute to viral pathogenesis?

Unlike some well-characterized Variola virus proteins, the specific contribution of Late protein H2 to viral pathogenesis remains an active area of investigation. Researchers can infer potential functions by studying the virus in humanized mouse models, where systemic disease development occurs following infection . Similar to other viral late proteins, H2R likely plays a role in viral morphogenesis, potentially contributing to the formation of mature viral particles as observed in transmission electron microscopy studies of infected tissues . Current research suggests that late proteins may be involved in the assembly of both immature and mature viral particles observed in infected cells.

What animal models are most suitable for studying the role of recombinant Variola virus proteins like H2R?

Recent advances have established humanized mouse models as the first viable small animal models for Variola virus research. Three types of humanized mice have been tested:

Mouse ModelSusceptibilityMortality Rate (High Dose)Viral ReplicationResearch Value
hu-BLT miceHighHighExtensiveExcellent - Complete human immune system with HLA restriction
hu-CD34+ miceHighHighExtensiveVery good - Naive human immune system with H2 class restriction
hu-PBMC miceModerateLowModerate-HighLimited - Less clinical disease manifestation

The hu-BLT and hu-CD34+ models demonstrate the highest potential for studying Variola virus proteins, as they exhibit systemic disease and high mortality following intranasal infection, with pathologic features resembling severe hemorrhagic smallpox . Researchers should prioritize these advanced models when investigating the role of specific proteins like H2R in viral pathogenesis.

What cell culture systems are optimal for expressing recombinant Variola virus Late protein H2?

For recombinant expression of Variola virus proteins, E. coli expression systems have been successfully employed for viral late proteins such as H7R . When designing expression constructs for H2R, researchers should consider:

  • Vector selection with appropriate promoters for prokaryotic expression

  • Inclusion of affinity tags (e.g., His-tag) for purification purposes

  • Codon optimization for the expression host

  • Expression conditions optimization (temperature, induction time, media composition)

For functional studies that require mammalian post-translational modifications, researchers might consider mammalian cell lines such as BHK-21, which have been successfully used for the generation of recombinant viruses in related research . The choice between prokaryotic and eukaryotic expression systems should be guided by the specific research questions being addressed.

What are the optimal conditions for expressing and purifying recombinant Variola virus Late protein H2?

Based on successful expression strategies for related viral proteins, the following protocol is recommended for H2R:

  • Clone the full-length H2R gene into an expression vector with an N-terminal His-tag

  • Transform into an E. coli expression strain (BL21(DE3) or similar)

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (0.1-1.0 mM) at reduced temperature (16-25°C) for 16-18 hours

  • Harvest cells by centrifugation and lyse using appropriate buffer systems

  • Purify using Ni-NTA affinity chromatography followed by size-exclusion chromatography

For storage, consider lyophilization with 6% trehalose in Tris/PBS-based buffer at pH 8.0, similar to protocols used for H7R protein . Avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C with 50% glycerol as a cryoprotectant .

What homologous recombination strategies can be applied to generate recombinant viruses expressing H2R for functional studies?

While direct work with Variola virus is highly restricted, researchers can adapt methodologies from related viruses to design research strategies. Based on recombinant pseudorabies virus generation techniques, the following approach could be considered for functional studies of H2R:

  • Select appropriate restriction enzyme sites for linearization of viral DNA (XbaI and AvrII sites have shown higher recombination efficiency in related viruses)

  • Design a donor vector containing the H2R gene with a reporter gene (e.g., EGFP) for easy identification

  • Co-transfect linearized viral DNA and the donor vector into appropriate cell lines

  • Monitor for cytopathic effects and reporter gene expression

  • Isolate and purify viral plaques exhibiting fluorescence

  • Confirm recombination by PCR and sequencing

This approach allows for the generation of recombinant viruses within 1-2 weeks after transfection, providing an efficient system for studying viral protein function in the context of viral replication .

How can researchers investigate the interaction between Variola virus Late protein H2 and host immune responses?

Investigating H2R interactions with host immune responses requires sophisticated experimental approaches:

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX)

  • Functional immunology approaches:

    • Assess cytokine responses to recombinant H2R in human peripheral blood mononuclear cells

    • Evaluate antigen presentation and T cell responses using humanized mouse models

    • Investigate antibody responses using serum from vaccinated individuals or convalescent smallpox patients

Researchers should note that humanized mouse models vary in their ability to generate human immune responses. While hu-BLT mice represent the most advanced model with a complete human immune system that is HLA restricted, current research indicates limitations in antibody production across all models, with no detectable levels of human IgM or IgG in ELISAs of infected animals .

What techniques are most effective for analyzing the role of H2R in viral morphogenesis and assembly?

To investigate H2R's role in viral morphogenesis, researchers should consider multiple complementary approaches:

  • Transmission electron microscopy (TEM):

    • Examine infected cells for viral particle formation and maturation

    • Compare wild-type virus with mutants lacking functional H2R

    • TEM has successfully distinguished between immature and mature Variola particles in infected tissues

  • Confocal microscopy with fluorescent tags:

    • Track the localization of H2R during different stages of viral replication

    • Co-localize H2R with other viral structural proteins or cellular markers

  • Viral genetics approaches:

    • Generate conditional mutants to study the temporal requirement for H2R

    • Perform complementation studies with H2R expressed in trans

These methodologies can help determine whether H2R, like other late viral proteins, contributes to the formation of both immature particles (typically found in hepatocytes) and mature virions (observed in sinusoidal endothelial cells and human fetal thymic allografts) .

What biosafety requirements must researchers follow when working with recombinant Variola virus proteins?

Work with recombinant Variola virus proteins, including H2R, requires strict adherence to biosafety guidelines:

  • Recombinant DNA work involving Variola virus genes typically requires BSL-2 containment with enhanced practices

  • Any work with infectious Variola virus is restricted to two WHO Collaborating Centers (CDC in Atlanta, USA and VECTOR in Koltsovo, Russia) under BSL-4 conditions

  • All research proposals involving Variola virus or its components must be approved by the WHO Advisory Committee on Variola Virus Research

Researchers should clearly label all materials containing recombinant Variola virus proteins with "Not For Human Consumption!" and implement proper disposal procedures for all waste materials .

What documentation and approvals are necessary for international collaborative research on Variola virus proteins?

International collaborative research on Variola virus proteins requires extensive documentation and approvals:

  • Institutional Biosafety Committee (IBC) approval from all participating institutions

  • Material Transfer Agreements (MTAs) for sharing recombinant proteins or constructs

  • Import/export permits for biological materials crossing international borders

  • Documentation of appropriate biosafety training for all personnel

  • For work with actual Variola virus genes (not just synthetic constructs based on published sequences), WHO Advisory Committee approval is required

Researchers should maintain detailed records of all approvals and permits, as regulatory requirements may vary between countries and institutions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.