Recombinant Variola virus Late protein H7 (H7R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us; we will prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
H7R
Target Protein Sequence
MEMDKRMKSLAMTAFFGELTTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDTYKA SQYLDLPLTPISGDECKTHASSIAKQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISQDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Q&A

How is the expression of H7R regulated during viral infection, and what methods can be used to study its temporal expression?

H7R expression is regulated as a late viral gene, with synthesis dependent on DNA replication. Research methodologies to study its temporal expression include:

Experimental approach:

  • Infect cells (e.g., BS-C-1 cells) with recombinant virus expressing tagged H7

  • Harvest at various time points post-infection (e.g., 6h, 9h, 12h, 24h)

  • Analyze protein synthesis by SDS-PAGE and Western blotting

  • Include cytosine arabinoside (AraC) treatment to block DNA replication

  • Use antibodies against both H7 and known late proteins (e.g., A3) as controls

Key findings:

  • H7 protein (17 kDa) shows a late time course of synthesis and accumulation

  • Expression is first detected at approximately 9 hours post-infection

  • No H7 is detected even at 24 hours when DNA replication is blocked with AraC

  • The promoter sequence contains TAAATG, indicative of a late promoter

This experimental design allows researchers to definitively characterize the temporal expression pattern of H7R and confirm its classification as a late protein.

What expression systems are available for producing recombinant H7R protein, and what are their relative advantages?

Several expression systems have been developed for producing recombinant H7R protein:

Expression SystemTagsAdvantagesLimitationsReference
E. coliN-terminal His-tag- Simple, high-yield production
- Cost-effective
- Suitable for structural studies
- May lack post-translational modifications
- Potential improper folding
- May form inclusion bodies
Sf9 insect cellsFlag tag, streptavidin-binding peptide- More suitable for functional studies
- Better folding
- Higher likelihood of proper post-translational modifications
- More expensive
- Lower yields
- More complex methodology
Inducible mammalian expressionHA epitope tag- Most physiological expression
- Useful for localization studies
- Compatible with rescue experiments
- Lowest yields
- Highest cost
- Most technical complexity

For successful purification of recombinant H7R, researchers should consider:

  • Lysis conditions (ionic vs. non-ionic detergents)

  • Affinity chromatography selection based on tag

  • Buffer optimization for stability and solubility

  • Quality control by functional assays (e.g., phospholipid binding)

What experimental approaches can be used to study the phosphoinositide binding properties of H7R, and how do mutations affect this function?

H7R has been identified as a phosphoinositide-binding protein that specifically interacts with phosphatidylinositol-3-phosphate (PI3P) and phosphatidylinositol-4-phosphate (PI4P) . To study this function, researchers can employ:

Methodological workflow:

  • Site-directed mutagenesis:

    • Target positively charged residues in the basic surface patch

    • Prepare alanine substitution mutants of key residues

    • Express and purify mutant proteins using affinity chromatography

  • Lipid binding assays:

    • Protein-lipid overlay assays using PIP strips

    • Liposome co-sedimentation assays

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional assays:

    • Transfect mutant constructs into cells infected with H7-deficient virus

    • Measure viral titer rescue and plaque formation

    • Analyze membrane structure formation by electron microscopy

    • Correlation of lipid binding with functional rescue

Key research findings:
Studies of the vaccinia H7 homolog demonstrated that mutation of positively charged residues in the phosphoinositide binding site disrupted both lipid binding and viral replication, establishing a direct link between these functions .

How can conditional mutant systems be designed to study the essential functions of H7R in viral replication?

Since H7R is essential for virus replication, conditional expression systems are necessary for functional studies. A methodology for creating and using such systems includes:

Experimental design:

  • Creation of inducible H7R expression system:

    • Replace the endogenous H7R gene with one regulated by a bacteriophage T7 promoter and E. coli lac operator

    • Include a parent virus containing both E. coli lac repressor and phage T7 RNA polymerase

    • Engineer repressor to be expressed constitutively under tandem early and late promoters

    • Make T7 polymerase inducible via a lac operator regulating a late promoter

  • Two-step virus construction:

    • First, insert H7 gene with epitope tag adjacent to T7 promoter and lac operator

    • Second, replace endogenous H7R gene with a marker (e.g., GFP)

    • Conduct homologous recombination in the presence of IPTG inducer

    • Clonally purify the resultant virus with inducible H7R expression

  • Functional analysis:

    • Conduct plaque formation assays ±IPTG

    • Perform one-step growth experiments at varying IPTG concentrations

    • Monitor H7 expression by Western blotting

    • Carry out complementation experiments with plasmids expressing wild-type H7

Validation findings:

  • The inducible H7 mutant produces plaques only when IPTG is present

  • Optimal virus yield occurs at ≥100 μM IPTG

  • In the absence of inducer, only single infected cells are observed

  • Complementation with plasmid-expressed H7 under its natural promoter increases infectious virus yield by ~10-fold

What ultrastructural changes occur in cells when H7R expression is repressed, and how can advanced microscopy techniques be applied to study these changes?

Repression of H7R expression leads to specific ultrastructural changes that can be studied using various microscopy techniques:

Methodological approach:

  • Confocal microscopy setup:

    • Infect cells with inducible H7R virus ±IPTG

    • Fix at various timepoints (6, 9, 12, 24 hours post-infection)

    • Use DAPI to stain DNA/viral factories

    • Employ antibodies against H7 and viral membrane/core proteins

    • Use fluorescent secondary antibodies for visualization

  • Transmission electron microscopy:

    • Prepare thin sections of infected cells

    • Use immunogold labeling for specific proteins

    • Examine membrane structures and viral factories

  • Advanced techniques to consider:

    • Correlative light and electron microscopy (CLEM)

    • Cryo-electron tomography for 3D ultrastructure

    • Super-resolution microscopy for detailed protein localization

    • Live-cell imaging with fluorescently tagged proteins

Key observations when H7 is repressed:

  • Large spherical inclusions containing viral core proteins appear within cytoplasmic factories

  • Inclusions are very dense, with antibodies binding only to surfaces (appearing as rings in Z-sections)

  • Crescent membranes and immature virions (IVs) are not formed

  • Some dense inclusions have membrane segments partially coated with spicules (D13 trimers)

  • Most D13 scaffold protein is present in separate intermediate-density inclusions associated with ER membranes

How does H7R interact with other viral membrane assembly proteins (VMAPs), and what methodologies can reveal these interactions?

H7R functions as part of a group of viral membrane assembly proteins (VMAPs) that collectively contribute to viral membrane biogenesis. These include A11, L2, A6, and A30.5 . To study these interactions:

Experimental approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with epitope-tagged proteins

    • Proximity labeling approaches (BioID, APEX)

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Split-GFP complementation assays

    • FRET/BRET to study interactions in living cells

  • Functional interaction studies:

    • Comparative analysis of conditional mutants for each VMAP

    • Complementation tests between different VMAP mutants

    • Synchronized induction/repression of multiple VMAPs

    • Analysis of membrane formation by electron microscopy

  • Structural approaches:

    • X-ray crystallography of VMAP complexes

    • Cryo-EM of multiprotein assemblies

    • Hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry

Research findings on H7R and other VMAPs:
Current evidence indicates that H7 and A11 (another VMAP) function at similar steps in morphogenesis, despite having no sequence homology. Both proteins:

  • Are expressed late in infection and not incorporated into mature virions

  • When repressed, inhibit processing of A17 membrane protein and core proteins

  • Prevent formation of crescent membranes and immature virions

  • Lead to formation of electron-dense inclusions containing core proteins

  • Result in intermediate-density inclusions containing D13 and ER membranes

How can subviral particle formation by recombinant H7R be analyzed, and what are the implications for vaccine development?

Some recombinant viral proteins, including hemagglutinin (HA) from influenza viruses, can form oligomeric structures called subviral particles (SVPs) that enhance immunogenicity. Similar approaches may be applicable to H7R:

Methodological workflow:

  • Production and purification of oligomeric H7R:

    • Express full-length H7R with transmembrane domain

    • Use mild detergent extraction

    • Perform size exclusion chromatography

    • Analyze oligomeric state by cross-linking experiments

  • Characterization of SVPs:

    • Negative stain electron microscopy to visualize particles

    • Dynamic light scattering for size distribution

    • Analytical ultracentrifugation for molecular weight determination

    • Circular dichroism for secondary structure analysis

  • Functional assessment:

    • Hemagglutination activity (if applicable)

    • Lipid binding assays

    • Stability assessment at various temperatures

    • Immunogenicity testing in animal models

Comparative findings from influenza research:
Studies with recombinant influenza H7 hemagglutinin show that the full-length protein forms oligomeric pleomorphic SVPs of ~20 nm diameter composed of approximately 10 HA0 molecules . These SVPs demonstrate:

  • Retained functional ability to agglutinate red blood cells

  • No significant quantities of free monomeric protein

  • High immunogenicity in mouse and ferret challenge models

These findings suggest that the formation of SVPs may be a general property of viral membrane proteins that could potentially be exploited for H7R studies and vaccine development.

How can researchers leverage Google's "People Also Ask" feature to identify emerging research questions about H7R protein?

Scientific literature searches can be supplemented with analysis of Google's "People Also Ask" (PAA) data to identify emerging research questions:

Methodological approach:

  • Data collection:

    • Perform searches for relevant terms ("Variola virus H7R protein," "poxvirus membrane formation," etc.)

    • Record PAA questions that appear

    • Click on questions to expand the PAA box and reveal additional related questions

    • Compile questions into a database

  • Analysis techniques:

    • Categorize questions by research domain

    • Identify knowledge gaps based on unanswered or partially answered questions

    • Track changes in questions over time to identify trending topics

    • Compare PAA results across different geographic regions

  • Application to research planning:

    • Use identified questions to develop research hypotheses

    • Address gaps in current knowledge with new experimental approaches

    • Structure research papers to directly answer common questions

    • Format findings to optimize visibility in PAA results

Key insights for researchers:

  • PAA questions appear in over 80% of English searches, generally within the first few results

  • Questions cascade down when clicked, revealing additional related queries

  • Content that directly answers questions in the first paragraph is more likely to be featured

  • Using question wording as title tags and H1 headings increases chances of selection for PAA results

This approach provides researchers with insights into what information other scientists and the public are seeking about H7R protein, potentially guiding more impactful research directions.

What are the challenges in studying authentic variola H7R function given the restrictions on variola virus research?

Studying authentic variola H7R function presents significant challenges due to biosafety restrictions:

Methodological workarounds:

  • Recombinant protein approaches:

    • Express variola H7R sequence in heterologous systems

    • Compare with vaccinia homolog in identical assays

    • Use commercially available recombinant proteins (e.g., His-tagged H7R)

    • Employ synthetic biology approaches with non-infectious components

  • Chimeric virus strategies:

    • Create vaccinia viruses expressing variola H7R

    • Develop complementation systems in H7-deficient vaccinia

    • Analyze function in appropriate cellular contexts

    • Compare with wild-type vaccinia controls

  • Computational approaches:

    • Molecular dynamics simulations of protein structure and interactions

    • Sequence-based evolutionary analysis across poxvirus species

    • Protein-protein interaction prediction

    • Virtual screening for potential inhibitors

Limitations to consider:

  • Authentic post-translational modifications may be missing in recombinant systems

  • Protein-protein interactions specific to variola may not be recapitulated

  • The cellular environment of human-specific infection cannot be fully modeled

  • Historical variola strains may have shown H7R sequence diversity not captured in available databases

What quality control methods should be employed when working with recombinant H7R protein to ensure functionality?

Ensuring the functionality of recombinant H7R protein requires rigorous quality control:

Quality control workflow:

  • Physical characterization:

    • SDS-PAGE for purity and expected molecular weight (17 kDa for untagged H7R)

    • Western blotting with specific antibodies

    • Mass spectrometry for precise mass determination and detection of modifications

    • Circular dichroism for secondary structure verification

  • Functional assays:

    • Phosphoinositide binding tests (PIP strips, liposome binding)

    • Oligomerization assessment by size exclusion chromatography

    • Thermal shift assays for stability determination

    • Electron microscopy for structural integrity

  • Biological activity tests:

    • Complementation of H7-deficient vaccinia virus

    • Cell-based membrane formation assays

    • Co-immunoprecipitation with known binding partners

    • Immunofluorescence for proper subcellular localization

Data-based quality benchmarks:
A properly folded, functional H7R protein should:

  • Form oligomeric structures rather than remain monomeric

  • Bind specifically to PI3P and PI4P phosphoinositides

  • Complement growth of H7-deficient vaccinia when expressed in trans

  • Not be incorporated into mature virions

These quality control steps ensure that experimental observations truly reflect H7R function rather than artifacts of improperly produced protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.