Recombinant Variola virus Protein A34 (A34R, A37R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
A34R; A37R; Protein A34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
A34R
Target Protein Sequence
MKSLNRQTVSRFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNTVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNNKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKRFYK
Uniprot No.

Target Background

Function
Essential for the envelopment of intracellular viral particles and the egress of enveloped virions from infected cells.
Database Links

KEGG: vg:1486515

Protein Families
Chordopoxvirinae A34 protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is Variola virus Protein A34 (A34R) and what is its general function?

Protein A34 is a type II transmembrane glycoprotein found in the outer envelope of the extracellular form of poxviruses, including vaccinia virus which shares significant homology with variola virus. A34 plays critical roles in virus egress, infectivity, actin tail induction, release of enveloped virus from infected cell surfaces, and the disruption of the virus envelope after ligand binding prior to virus entry . Functionally, A34 serves as a major determinant in the protein composition of the virus envelope, influencing both the structural integrity and infectious potential of extracellular virions .

How does A34R's structure relate to its function?

A34R's structure includes a transmembrane domain and an ectodomain that mediates interactions with other viral proteins. Research demonstrates that A34 interacts with envelope protein B5 through their respective ectodomains, as confirmed by experiments with various B5 mutants lacking cytoplasmic and transmembrane domains . This structural arrangement facilitates proper viral envelope assembly and protein incorporation. Importantly, A34's type II transmembrane orientation (with the C-terminus exposed on the virion surface) permits the addition of epitope tags like HA without completely disrupting function, though some functional reduction is observed .

What methods are available for studying A34R expression in infected cells?

Several methodological approaches have proven effective for studying A34R expression:

  • Epitope tagging: Adding epitopes like hemagglutinin (HA) to the C-terminus allows for detection using commercial antibodies. This approach enabled the construction of recombinant virus vA34R<sup>HA</sup> expressing epitope-tagged A34 .

  • Immunofluorescence microscopy: This technique reveals A34's distribution in infected cells, showing strong juxtanuclear staining and punctate staining of peripheral virions .

  • Protein interaction analysis: Coimmunoprecipitation using antibodies against specific viral proteins followed by Western blot analysis with anti-HA antibody has successfully identified A34's interactions with other viral envelope proteins .

  • Real-time cell analysis (RTCA): Systems like xCELLigence allow for monitoring the cytopathic effect in cells infected with viruses containing wild-type or mutant A34 .

Which viral proteins interact with A34R and how can these interactions be studied?

Research has identified specific interactions between A34 and other viral envelope proteins:

A34 has been demonstrated to form complexes with B5 and A36, but not with A33 or F13 in vaccinia virus-infected cells . These interactions were discovered using coimmunoprecipitation experiments with tagged versions of A34 (A34<sup>HA</sup>) .

Methodological approach for studying these interactions:

  • Generate recombinant virus expressing epitope-tagged A34

  • Prepare extracts from infected cells

  • Perform immunoprecipitation with antibodies against potential interacting partners

  • Conduct Western blot analysis with anti-epitope antibody

  • Confirm interactions through reciprocal immunoprecipitation experiments

This approach successfully identified A34's interaction partners and defined the domains required for these interactions .

What domains of A34R are involved in protein-protein interactions?

Research using recombinant viruses expressing mutated versions of interacting proteins has revealed that:

  • A34 interacts with envelope protein B5 through their respective ectodomains

  • Both the cytoplasmic and transmembrane domains of B5 are dispensable for binding to A34

  • Most of the extracellular domain of B5, which contains four short consensus repeats homologous to complement control proteins, is sufficient for A34 interaction

These findings indicate that A34 and B5 primarily interact through their ectodomains, a critical insight for understanding how these proteins function together in the viral envelope .

How does A34R affect incorporation of other proteins into the viral envelope?

A34 plays a crucial role in determining the protein composition of the viral envelope. Experimental evidence from immunofluorescence and biochemical analyses of A34-deficient viruses reveals:

  • A34 is required for efficient targeting of B5, A36, and A33 into wrapped virions

  • In A34-deficient virus-infected cells, B5 shows poor colocalization with peripheral virions

  • A33 fails to label DNA-containing virus particles in A34-deficient infected cells

  • A36 produces diffuse staining in A34-deficient infected cells and does not label peripheral virus particles

  • In contrast, F13 incorporation into enveloped virions is not dependent on A34

These findings demonstrate A34's critical role as a determinant of viral envelope composition, with Western blot analysis of extracellular virions confirming decreased amounts of B5 and A33 but normal amounts of F13 in A34-deficient virus compared to wild-type .

What is the effect of A34R deletion on virus transmission and actin tail formation?

Deletion of A34R has significant consequences for virus functionality:

  • Virus transmission: A34-deficient virus (vΔA34R) produces elevated amounts of enveloped virions but with reduced infectivity, resulting in a tiny plaque phenotype. This indicates severe defects in virus cell-to-cell transmission .

  • Actin tail formation: A34R deletion completely abrogates the ability of vaccinia virus to induce actin tails. This was confirmed by TRITC-phalloidin staining and fluorescence microscopy of infected cells .

  • Functional complementation: When A34<sup>HA</sup> is introduced into an A34-deficient background, the recombinant virus (vA34R<sup>HA</sup>) regains the ability to form actin tails and produces larger plaques than the A34-deficient virus, though not as large as wild-type virus plaques. This indicates that epitope-tagged A34 can functionally replace normal A34 protein, albeit with reduced efficiency .

What recombinant systems are most effective for studying A34R function?

Several recombinant systems have proven valuable for studying A34R function:

  • Epitope-tagged recombinant viruses: Adding epitope tags (like HA) to A34 enables tracking and analysis of the protein without generating specific antibodies. The construction of vA34R<sup>HA</sup> by appending an HA epitope to the C-terminus of A34 provided a functional tagged protein that could be detected by Western blotting and immunofluorescence .

  • Deletion mutants: Generation of A34-deficient viruses (vΔA34R) allows for studying the consequences of A34 absence on virus morphogenesis and transmission .

  • Complementation systems: Reintroducing wild-type or mutant versions of A34 into A34-deficient backgrounds enables functional studies of specific domains or residues .

  • Combined deletion/tagging approaches: Systems like vA34R<sup>HA</sup>ΔB5R, in which 94% of the B5R coding sequence is replaced with a fluorescent protein expression cassette, allow for studying interactions between viral proteins and the consequences of combined mutations .

How can advanced microscopy techniques be applied to study A34R localization and trafficking?

Advanced microscopy techniques provide powerful tools for studying A34R localization and trafficking:

  • Immunofluorescence combined with DNA staining: This approach enables visualization of A34 in relation to virus particles. Using DNA stains like Hoechst in combination with immunofluorescence for viral proteins allows distinction between protein in vesicles versus viral particles .

  • Colocalization analysis: Performing double or triple immunofluorescence with antibodies against multiple viral proteins helps determine the degree of colocalization and potential interactions .

  • Live-cell imaging: For studying dynamic events like virus egress and actin tail formation, live-cell imaging of cells infected with recombinant viruses expressing fluorescently tagged A34 can be employed.

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED can provide nanoscale resolution of A34 localization relative to other viral or cellular components.

What proteomics approaches are useful for analyzing A34R interactions and modifications?

Several proteomics approaches can provide valuable insights into A34R:

  • Tandem mass spectrometry (LC-MS/MS): This technique can identify proteins in purified virus particles, revealing changes in protein composition between wild-type and mutant viruses .

  • Immunoprecipitation coupled with mass spectrometry: This approach can identify novel interaction partners of A34 beyond those already known.

  • Quantitative proteomics: Methods like label-free quantification (LFQ) can measure relative abundances of viral proteins in different samples, allowing comparison between wild-type and A34-deficient viruses .

  • Post-translational modification analysis: Mass spectrometry can identify glycosylation, phosphorylation, and other modifications of A34 that may regulate its function.

How might structural studies of A34R contribute to antiviral development?

Structural studies of A34R could contribute to antiviral development in several ways:

  • Identification of functional domains: Determining the three-dimensional structure of A34 would provide insights into domains critical for its function in viral assembly and transmission.

  • Interface mapping: Characterizing the molecular interfaces between A34 and its interaction partners (B5, A36) could reveal potential targets for small molecule inhibitors that disrupt these interactions.

  • Rational drug design: With structural information, researchers could design compounds that specifically bind to A34 and interfere with its functions in virus assembly or cell-to-cell spread.

  • Epitope identification: Structural studies could identify protective epitopes on A34 for targeted vaccine development against poxviruses.

What genomic approaches can be used to study A34R evolution across poxvirus species?

Several genomic approaches are valuable for studying A34R evolution:

  • Comparative genomics: Sequence comparison of A34R homologs across different poxvirus species can reveal conserved regions likely essential for function versus variable regions that may contribute to host specificity.

  • Phylogenetic analysis: Constructing phylogenetic trees based on A34R sequences can help understand the evolutionary relationships among poxviruses and potential host adaptation events.

  • Selection pressure analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) can identify regions of A34R under positive or negative selection.

  • Next-generation sequencing (NGS): As demonstrated in the research on cowpox virus adaptation, NGS can track genetic changes in viral populations during passaging in different cell types, potentially revealing adaptation-related mutations in A34R .

How does the function of A34R in Variola virus compare to its homologs in other poxviruses?

While direct experimental data on Variola virus A34R is limited due to restrictions on smallpox virus research, comparative analysis suggests:

  • The high sequence similarity between poxvirus homologs suggests functional conservation across different poxvirus species.

  • Studies with vaccinia virus A34R provide a model system for understanding the likely functions of Variola virus A34R.

  • Any differences in A34R function between Variola and other poxviruses could contribute to the unique pathogenicity of smallpox.

  • The interactions between A34 and other envelope proteins appear to be a conserved feature across poxviruses, with potential variations that might influence host range or tissue tropism.

What are common challenges in expressing and purifying recombinant A34R for functional studies?

Researchers face several challenges when working with recombinant A34R:

  • Membrane protein expression: As a type II transmembrane glycoprotein, A34R can be difficult to express in soluble form for biochemical and structural studies.

  • Maintaining proper folding: Ensuring correct folding and post-translational modifications (especially glycosylation) is essential for functional studies.

  • Protein-protein interactions: A34R's functions depend on interactions with other viral proteins, making it necessary to co-express interaction partners for certain studies.

  • Epitope tag interference: While epitope tags facilitate detection and purification, they may partially interfere with function, as seen with the reduced plaque size of vA34R<sup>HA</sup> compared to wild-type virus .

  • Purification challenges: Detergent selection for membrane protein extraction without disrupting protein-protein interactions requires careful optimization.

How can researchers optimize cell culture systems for studying A34R function?

Optimizing cell culture systems for A34R studies requires consideration of several factors:

  • Cell line selection: Different cell lines may affect virus replication and A34R function. For example, HEp-2 (human epithelial) cells versus Rat-2 (rat fibroblast) cells show different cytopathic effects and virus yields during viral adaptation .

  • MOI optimization: Multiplicity of infection affects the synchronicity of infection and expression levels of viral proteins.

  • Real-time monitoring: Systems like xCELLigence RTCA allow continuous monitoring of the cytopathic effect in infected cells, providing insights into the kinetics of virus-induced changes .

  • Passage number control: During serial passaging, viruses may adapt to cell culture conditions, potentially affecting A34R function or interactions .

  • Quantification methods: Using quantitative PCR to determine genome equivalents helps standardize infections across different virus stocks and cell types .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.