Recombinant Variola virus Protein E8 (E8R)

Shipped with Ice Packs

In Stock

Cat. No.

BT2446881

Source

in vitro E.coli expression system

Quick Inquiry

Description

Research Findings

Research has explored the role of E8R through various experiments, including the characterization of temperature-sensitive mutants and protein-protein interaction studies .

2.1. Temperature-Sensitive Mutants

Two temperature-sensitive mutants, Dts23 and Cts19, have been instrumental in studying E8R function .

Dts23 contains a missense mutation (L81F) in the E8R coding region .
Cts19 has a mutation (M1I) in the initiating methionine codon .

Dts23 virions produced at the non-permissive temperature (39.7 °C) contain reduced amounts of E8 and have a high particle-to-infectivity ratio. Cts19 virions grown at 31 °C also show reduced infectivity and do not contain detectable E8. Dts23 grown at 39.7 °C can enter cells but fails to synthesize early mRNA or produce CPE (cytopathic effect) .

2.2. Protein-Protein Interactions

Yeast two-hybrid (Y2H) screens have identified several candidate interacting human proteins with WR064 (COP-E8) . These interactions provide insights into how vaccinia viruses modulate host cells during infection .

2.3. Impact on Viral Replication

E8 is essential for the formation of transcriptionally active virus cores . Studies using temperature-sensitive mutants indicate that while viral assembly can still occur without functional E8, the resulting virions are less infectious and have impaired transcriptional activity .

Data Tables

The following tables summarize key data regarding the E8 protein and its mutants:

Feature	Wild-Type VACV	Dts23	Cts19
E8 Protein Synthesis	Late during infection	Reduced at non-permissive temperature	Absent under both permissive and non-permissive conditions
Virion Morphology	Normal	Normal	Severely impaired at the non-permissive temperature
Infectivity	Normal	Reduced at non-permissive temperature	Reduced even at permissive temperature; severely impaired at the non-permissive temperature
Core Transcription Activity	Normal	Defective in intact cores at non-permissive temperature	Not detectable due to lack of E8
Early mRNA Synthesis	Normal	Blocked at non-permissive temperature	Not assessed

Product Specs

Form

Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have special requirements. We will fulfill your request to the best of our ability.

Lead Time

Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped on blue ice unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.

Shelf Life

Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type is determined during the manufacturing process.

If you require a specific tag type, please inform us. We will prioritize the development of your specified tag.

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-273

Protein Length

full length protein

Species

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Target Names

E8R

Target Protein Sequence

MAAVVPRFDDVYKNAQRRILDQETFFSRGLGRPLMKNTYLFDNYAYGWIPETAIWSSRYA NLDASDYYPISLGLLKKFKFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSAL PTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYK PLFSRLKENYIFTGPVPIGIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLL FYVPGYSITTKITPAVEYLMDKLKLTKNDVQLL

Uniprot No.

P33820

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Variola virus Protein E8 (E8R)

Description

Research Findings

2.1. Temperature-Sensitive Mutants

2.2. Protein-Protein Interactions

2.3. Impact on Viral Replication

Data Tables

Product Specs

Quick Inquiry

Category

Service