Recombinant Variola virus Protein J5 (J5L, L5L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
J5L; L5L; Protein J5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
J5L
Target Protein Sequence
MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ISRCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF
Uniprot No.

Target Background

Function

Function: The envelope protein of the entry-fusion complex mediates viral membrane fusion with the host cell membrane during viral entry. It also contributes to cell-cell fusion (syncytium formation).

Database Links

KEGG: vg:1486468

Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the biological significance of the J5 protein in poxvirus infection?

J5 protein serves as a critical component of the entry fusion complex (EFC) in poxviruses, with essential roles in the viral infection cycle. Experimental evidence demonstrates that J5 enables core entry into host cells post-binding and induces syncytium formation between infected cells . Depletion studies have shown that reducing J5 expression leads to approximately 60-fold reduction in infectious virus yield, while still allowing virions to bind to cell surfaces but failing to penetrate the membrane. The protein functions synergistically with other EFC components embedded in the mature virion (MV) membrane to facilitate viral entry and subsequent infection .

How does J5 structurally compare to L5, and what are their distinct functional roles?

Both J5 and L5 serve as integral components of the poxvirus entry fusion complex, but with distinctive structural and functional characteristics:

CharacteristicJ5 (J5L)L5 (L5L)
Primary functionCore entry post-binding; syncytium formationMV membrane fusion
Effect of depletion60-fold reduction in virus yieldComplete blockage of virion production
Structural featuresEctodomain (2-68 a.a) structure determined by NMRSurface-exposed on MVs; confirmed by biotinylation
InteractionsCo-purifies with A28, H2, and L5Critical component of EFC complex
Genetic identifierMVA089L (WR strain)-

L5 appears to play a more absolute role in viral infectivity, as its silencing blocks virion production entirely, while J5 reduction severely impairs but doesn't completely eliminate infectivity. The structural-functional relationship between these proteins reflects their coordinated but distinct roles in facilitating viral entry into host cells.

What are the optimal expression systems for producing recombinant J5 protein for structural studies?

Based on successful structural characterization approaches, recombinant J5 ectodomain has been effectively produced for NMR studies . While the search results don't specify the exact expression system used for the published structure, several methodological considerations are critical:

  • Expression system selection: E. coli-based systems are commonly employed for structural biology studies of viral proteins, particularly when working with defined domains rather than full-length transmembrane proteins.

  • Domain optimization: The successful NMR structure focused on the ectodomain (residues 2-68), suggesting that expressing this region rather than the full-length protein may improve yield and stability .

  • Purification strategy: For structural studies, affinity chromatography approaches (e.g., streptactin affinity chromatography used in interaction studies) followed by size exclusion chromatography are recommended to achieve the high purity required.

  • Isotopic labeling: For NMR studies, incorporation of 15N and potentially 13C isotopes is necessary, requiring expression in minimal media with appropriate isotope-enriched nitrogen and carbon sources.

Researchers should consider using conditional expression systems similar to the IPTG-regulated systems that have successfully been employed in functional studies of these proteins.

What techniques have proven most effective for studying J5-host protein interactions?

Several complementary approaches have demonstrated effectiveness in studying J5 interactions:

  • Proteomic analysis: Mass spectrometry has successfully identified J5 interactions with other EFC components, providing a pathway for identifying potential host interaction partners.

  • Conditional mutants: IPTG-regulated J5 expression systems have enabled researchers to create conditional knockdowns, which are valuable for studying protein function in the viral context without requiring separate expression systems.

  • Affinity purification: Streptactin affinity chromatography has effectively co-purified J5 with other viral proteins (A28, H2, and L5), suggesting this approach could be adapted to identify host interaction partners.

  • Topology mapping: Techniques such as sulfosuccinimidyl biotinylation, which confirmed L5's extracellular orientation, can be applied to J5 to determine which domains are accessible for host interactions.

When designing experiments to identify J5-host protein interactions, researchers should consider using BioID or proximity labeling approaches combined with mass spectrometry, as these methods are particularly suited for identifying transient interactions that might occur during the dynamic process of viral entry.

How can the structural data of J5 inform the design of fusion inhibitors?

The solution NMR structure of the J5 ectodomain (PDB: 8WT5) provides a valuable starting point for structure-based drug design approaches targeting poxvirus entry . Researchers should focus on:

  • Binding pocket identification: Computational analysis of the J5 structure to identify potential small molecule binding sites, particularly those that might disrupt interactions with other EFC components.

  • Interface targeting: Since J5 co-purifies with other EFC proteins (A28, H2, and L5), identifying the interaction interfaces could guide the design of peptide-based inhibitors that disrupt complex formation.

  • Functional domain targeting: Given J5's role in core entry and syncytium formation, compounds targeting the domains responsible for these functions could effectively inhibit viral infection.

  • Virtual screening approaches: Using the NMR structure to conduct in silico screening of chemical libraries, prioritizing FDA-approved compounds as potential repurposing candidates, similar to the approach described in the high-throughput screening research .

The recent determination of the J5 ectodomain structure significantly advances the potential for rational design of entry inhibitors, which could complement the cell-based screening approaches previously employed to identify poxvirus inhibitors .

What are the key considerations when designing assays to evaluate inhibitors of J5 function?

When developing assays to evaluate potential J5 inhibitors, researchers should consider several critical aspects:

  • Specificity assessment: Design control experiments to distinguish between compounds that specifically target J5 versus those affecting other components of the EFC or general membrane fusion processes.

  • Stage-specific inhibition: Develop assays that can distinguish between inhibition of binding versus post-binding entry events, since J5 is specifically involved in the latter.

  • Syncytium formation assay: Since J5 plays a role in syncytium formation, a quantifiable assay measuring cell-cell fusion following low pH treatment could specifically evaluate J5 function .

  • Biochemical interaction assays: Surface plasmon resonance or fluorescence-based binding assays to measure disruption of J5's interaction with other EFC components.

  • Structural confirmation: NMR-based approaches to confirm binding of inhibitory compounds to the recombinant J5 ectodomain, leveraging the available structural data .

A multi-layered approach combining these assays will provide more robust characterization of potential inhibitors and help distinguish between compounds affecting different stages of viral entry.

How conserved is J5 across different poxvirus species, and what are the implications for broad-spectrum inhibitor development?

J5 represents one of the nine proteins considered integral components of the entry fusion complex that are conserved across all poxviruses . This conservation suggests several important considerations:

  • Conservation analysis: While specific sequence identity percentages aren't provided in the search results, the fact that J5 is conserved across the poxvirus family indicates functional constraints that limit sequence divergence. This conservation makes J5 an attractive target for broad-spectrum inhibitors.

  • Variola-specific features: The J5L protein from variola virus (the causative agent of smallpox) represents a particularly important variant to study, as inhibitors targeting conserved features of this protein could potentially protect against this high-consequence pathogen .

  • Cross-species activity: Experimental evidence from vaccinia virus (VACV) homologs demonstrates synergistic action within the EFC, suggesting that mechanistic insights from VACV studies are likely applicable to understanding J5 function across poxvirus species.

  • Rational design approach: Targeting the most highly conserved regions of J5, particularly those with structural or functional importance identified in the NMR studies, would offer the best opportunity for developing broad-spectrum inhibitors .

Given its conservation and essential role, J5 represents a promising target for developing antivirals with activity against multiple poxvirus species, including potential emerging threats.

What functional differences exist between J5 in laboratory-adapted strains versus clinical isolates?

  • Strain variation context: Different VACV strains (WR, MVA, IHD-J, Copenhagen, and Lister) are mentioned as being used in research, suggesting potential strain-specific differences in viral proteins .

  • Entry pathway differences: There's evidence that VACV strains differ in their entry pathways, with the A25 and A26 proteins serving as fusion suppressors that determine strain-specific virus entry pathways . This suggests that the functional context in which J5 operates may differ between strains.

  • Research approach: To address this question experimentally, researchers could:

    • Compare J5 sequences across laboratory-adapted strains and clinical isolates

    • Construct chimeric viruses with J5 variants from different sources

    • Assess entry efficiency and mechanism in different cell types

    • Evaluate neutralization by antibodies targeting different J5 epitopes

  • Methodological consideration: The use of both Western Reserve strain and variola virus J5 in different research contexts suggests that comparative studies between orthopoxvirus species might provide insights into functional conservation and divergence.

This knowledge gap represents an important area for future research, particularly for understanding the potential effectiveness of J5-targeted interventions against naturally occurring poxvirus infections.

What are the primary challenges in producing functional recombinant J5 protein, and how can they be addressed?

Producing functional recombinant poxvirus proteins like J5 presents several technical challenges:

  • Membrane association: J5 is a component of the EFC embedded in the viral membrane , suggesting it may have hydrophobic regions that complicate expression and purification. Researchers have addressed this by focusing on the ectodomain (residues 2-68) for structural studies .

  • Protein folding and stability: Viral membrane proteins often require specific conditions for proper folding. Consider:

    • Expressing with fusion partners to enhance solubility

    • Testing multiple expression temperatures

    • Using specialized E. coli strains designed for membrane or disulfide-containing proteins

    • Employing detergents or lipid environments during purification

  • Functional verification: Confirming that recombinant J5 retains native functionality can be challenging. Approaches include:

    • Binding assays with other EFC proteins

    • Structural characterization compared to native protein

    • Complementation studies in J5-deficient viral systems

  • Expression system selection: While bacterial systems may work for domains, eukaryotic expression systems (insect or mammalian cells) might be required for full-length, properly folded protein with appropriate post-translational modifications.

The successful NMR structure determination of the J5 ectodomain demonstrates that at least this portion of the protein can be produced in a form suitable for structural studies , providing a foundation for further biochemical and functional analyses.

How can researchers troubleshoot inconsistent results in J5 inhibition assays?

When facing inconsistent results in J5 inhibition assays, researchers should systematically evaluate several potential sources of variability:

  • Assay-specific considerations:

    • For syncytium formation assays: Ensure consistent cell density, fusion triggering conditions, and quantification methods

    • For viral entry assays: Control for variations in virus preparation, MOI, and cell passage number

    • For biochemical interaction assays: Verify protein quality and stability batch-to-batch

  • Control implementation:

    • Include both positive controls (known inhibitors of viral entry) and negative controls

    • Implement internal standards to normalize results across experiments

    • Consider using multiple orthogonal assays to confirm inhibitory activity

  • Technical optimization:

    • Standardize protocols for reagent preparation and storage

    • Establish acceptance criteria for assay performance

    • Consider automation to reduce operator variability

  • Biological variability management:

    • Test inhibitors against multiple poxvirus strains to assess spectrum of activity

    • Evaluate activity in multiple cell types to identify cell-specific effects

    • Assess compound stability under assay conditions

  • Data analysis approach:

    • Implement robust statistical methods appropriate for the assay type

    • Consider dose-response relationships rather than single-concentration testing

    • Evaluate kinetic parameters when possible rather than endpoint measurements

A systematic troubleshooting approach addressing these factors will help identify sources of variability and improve assay reproducibility for J5 inhibition studies.

What emerging technologies show promise for uncovering novel functions of J5 in poxvirus biology?

Several cutting-edge technologies hold significant potential for expanding our understanding of J5 functions:

  • Cryo-electron tomography: While solution NMR has provided valuable structural information about the J5 ectodomain , cryo-ET could reveal the arrangement and interactions of J5 within the native viral membrane context as part of the intact EFC.

  • Single-molecule imaging techniques: Super-resolution microscopy approaches could track the dynamics of J5 during the viral entry process, potentially revealing transient interactions and conformational changes not captured by static structural studies.

  • CRISPR interference in host cells: CRISPRi screens targeting host factors could identify previously unknown cellular components that interact with J5 during entry, expanding our understanding beyond the current focus on viral protein interactions.

  • Hydrogen-deuterium exchange mass spectrometry: This approach could map conformational changes in J5 under different conditions, potentially revealing how it contributes to membrane fusion.

  • In situ structural methods: Techniques like XL-MS (crosslinking mass spectrometry) could capture J5's interaction network within intact virions, providing insights into the higher-order organization of the EFC.

These technologies could address key knowledge gaps regarding J5's precise mechanism of action during viral entry, potentially revealing novel functions beyond its established role in the EFC.

How might understanding J5-host interactions inform our comprehension of poxvirus immune evasion strategies?

While the search results don't directly address J5's role in immune evasion, understanding its interactions with host factors could provide important insights:

  • Potential immune recognition: As a virion surface protein, J5 could be a target for neutralizing antibodies. Understanding whether poxviruses have evolved mechanisms to shield or modify J5 to evade antibody recognition would be valuable.

  • Host pathway hijacking: J5's role in membrane fusion and entry suggests interaction with host membrane components. These interactions might compete with or modify host signaling pathways involved in immune response.

  • Pattern recognition interference: The search results mention that poxviruses employ multiple strategies to evade immune detection, including blocking pattern recognition receptors . Investigation of whether J5 contributes to these processes could reveal new immune evasion functions.

  • Research approach integration: Combining J5 structure-function studies with analysis of host immune response could leverage:

    • The available NMR structure to identify potential immune recognition epitopes

    • Protein-protein interaction studies to identify host factors that interact with J5

    • Comparative analysis of J5 across poxvirus species to identify regions under selective pressure from immune recognition

This integrative approach could potentially reveal unexpected roles for J5 in the complex host-pathogen interaction landscape of poxvirus infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.