Recombinant Variola virus Protein L1 (L1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its incorporation.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-250
Protein Length
Full Length of Mature Protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
L1R
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDIQN
Uniprot No.

Q&A

What is Variola virus Protein L1 (L1R) and what is its significance in orthopoxvirus research?

L1R is a conserved gene in orthopoxviruses that encodes the L1 membrane protein, which plays a critical role in viral entry and is an important target for neutralizing antibodies. The L1 protein is expressed as a dimer of approximately 25-27 kDa . As a component of the mature virion membrane, L1 is essential for virus infectivity and represents a significant target for vaccine development.

The study of L1R is particularly important because variola virus, the causative agent of smallpox, has been eradicated from nature, but research continues on its components to develop better vaccines and antivirals. The L1 protein has been identified as one of the key immunogenic proteins that can elicit protective neutralizing antibodies against orthopoxviruses .

How is L1R conserved across different orthopoxviruses and what does this reveal about viral evolution?

The L1R gene shows strong conservation among orthopoxviruses, including variola virus, vaccinia virus, and monkeypox virus. This conservation reflects the essential nature of the L1 protein in the viral life cycle. Comparative genomic analyses have shown that despite the fragmentation of several genes in variola virus compared to vaccinia virus, genes encoding structural proteins like L1 maintain functional integrity .

The evolutionary analysis of variola virus, which has a substitution rate of approximately 8.5 × 10^-6 nucleotide substitutions per site per year , suggests that essential structural genes like L1R evolved under strong selective pressure to maintain function. This conservation makes L1R an attractive target for broad-spectrum orthopoxvirus vaccines and therapeutics.

What expression systems are most effective for producing recombinant L1R protein?

Several expression systems have been utilized for L1R production, with varying degrees of success. Recent research demonstrates that fowlpox virus-based expression systems can effectively produce recombinant L1 protein, particularly when enhanced with a tissue plasminogen activator (tPA) signal sequence .

The expression of L1R has been successful in different cell types, including chicken embryo fibroblasts (CEF), non-human primate Vero cells, and human MRC-5 cells . The research indicates that addition of the tPA signal sequence significantly enhances expression levels and enables proper protein localization, making this approach particularly valuable for vaccine development.

How can the expression and localization of L1 protein be monitored in experimental systems?

The expression and localization of L1 protein can be monitored through several complementary techniques:

  • RT-PCR analysis: To detect L1R gene transcription, with expression detectable for up to 34 days post-infection in some cell lines .

  • Immunoprecipitation: After protein labeling with ^35S L-Met, L1 protein can be precipitated using specific rabbit polyclonal antibodies, revealing the characteristic dimer of 25-27 kDa .

  • Immunofluorescence assays: These can distinguish between intracellular and membrane-associated L1 protein. When using the tPA signal sequence-enhanced construct (tPA-L1R), the protein shows both cytoplasmic and membrane localization in CEF, Vero, and MRC-5 cells .

The combination of these methods provides comprehensive monitoring of both L1R gene expression and protein production, enabling researchers to optimize experimental conditions.

How does the addition of a tPA signal sequence affect L1 protein expression and potential vaccine efficacy?

The addition of a tissue plasminogen activator (tPA) signal sequence to the 5' end of the L1R gene significantly enhances expression and alters the subcellular localization of the L1 protein. Research has demonstrated that the FP-tPA-L1R recombinant (fowlpox virus expressing tPA-linked L1R) produces a functional heterologous protein that:

  • Can be immunoprecipitated by hyperimmune rabbit serum

  • Shows both cytoplasmic and membrane subcellular localizations

  • Demonstrates long-lasting expression in multiple cell types (CEF, Vero, and MRC-5 cells)

This enhanced expression is not observed in constructs lacking the tPA signal sequence (FP-L1R). The tPA signal sequence directs the protein into the cellular secretion pathway, which may improve its presentation to the immune system. This modification could potentially enhance the immunogenicity of L1R-based vaccines, particularly in prime-boost vaccination regimens combining DNA and viral vector-based vaccines .

What prime-boost vaccination strategies show promise for L1R-based vaccines?

Research indicates that prime-boost strategies combining different vaccine platforms may enhance immune responses to L1R. While DNA recombinant vaccines expressing this protein have shown some success, they demonstrated lower efficacy in non-human and human primates when used alone .

A promising approach involves combining:

  • DNA vaccines expressing L1R for priming

  • Fowlpox-based viral vector vaccines (such as FP-tPA-L1R) for boosting

This heterologous prime-boost strategy could potentially overcome the limitations of single-platform approaches. The enhanced expression achieved with the tPA signal sequence in the fowlpox vector may contribute significantly to improving the immunogenicity of such vaccines . Research continues to determine optimal dosing, intervals, and specific combinations for maximizing protective immunity.

What are the key limitations in studying authentic variola virus proteins like L1R?

Research with variola virus components faces several significant challenges:

  • Regulatory restrictions: Following smallpox eradication, research with variola virus is highly regulated and restricted to only two WHO-designated repositories .

  • Lack of natural animal models: Variola virus naturally infects only humans, limiting the study of authentic virus-host interactions. Even experimental primate models do not fully recapitulate human smallpox disease .

  • Biosafety concerns: Working with viable variola virus requires maximum containment facilities (BSL-4).

  • Ethical considerations: The continued existence of variola virus stocks remains controversial, with periodic World Health Assembly debates about destruction of remaining stocks .

These challenges have led researchers to use recombinant approaches, working with individual variola virus proteins like L1R rather than the intact virus, and using related orthopoxviruses as models. Recent advances include the development of humanized mouse models for variola virus infection, which may facilitate testing of L1R-based vaccines and therapeutics .

How can researchers overcome challenges in purifying functional L1 protein for structural and immunological studies?

Purification of functional L1 protein presents several challenges due to its membrane-associated nature and conformational epitopes. Successful strategies include:

  • Use of the tPA signal sequence: This modification improves expression and may facilitate purification by directing the protein through the secretory pathway .

  • Immunoprecipitation techniques: Using rabbit polyclonal antibodies to capture the native protein, preserving its conformational epitopes that may not be detected by Western blotting .

  • Maintaining native conformation: Since conformational integrity appears critical for proper antibody recognition, gentle purification conditions should be employed to preserve protein structure.

  • Expression in mammalian cells: While bacterial expression systems might yield larger quantities, expression in mammalian cells (such as Vero or MRC-5) can provide properly folded and post-translationally modified L1 protein that better mimics the authentic viral antigen .

How does genomic research on historical variola virus specimens inform our understanding of L1R and vaccine development?

Recent genomic analysis of historical variola virus specimens, such as the 17th-century specimen (VD21) recovered from a Lithuanian mummy, provides important insights into the evolution of variola virus proteins including L1R. This research has revealed that:

  • Historical variola virus genomes show strong conservation in gene content and arrangement compared to 20th-century isolates .

  • Many gene disruptions characteristic of modern variola virus strains had already occurred by the mid-17th century, suggesting that viral evolution and host adaptation occurred relatively early .

  • The evolutionary rate of variola virus is estimated at 7.3-9.6 × 10^-6 nucleotide substitutions per site per year .

This evolutionary perspective informs the design of recombinant L1R-based vaccines by identifying conserved epitopes that have remained stable over centuries. Such conserved regions are likely to represent functionally critical domains of the protein and therefore promising targets for vaccine and therapeutic development.

What novel approaches are being explored to enhance immune responses to recombinant L1R protein?

Current research is exploring several innovative approaches to enhance immune responses to recombinant L1R:

  • Signal sequence optimization: The tPA signal sequence has shown promise in enhancing L1 protein expression and possibly immunogenicity .

  • Heterologous prime-boost strategies: Combining DNA vaccines with viral vector-based vaccines expressing L1R to maximize both cellular and humoral immunity .

  • Multi-antigen approaches: Combining L1R with other immunogenic orthopoxvirus proteins to broaden protective immunity.

  • Novel adjuvant formulations: Exploring adjuvants that specifically enhance neutralizing antibody responses to membrane proteins like L1.

  • Expression system optimization: Long-term expression has been demonstrated in various cell types, with peak expression at 4-7 days post-infection and detectable expression for up to 34 days in some systems .

These approaches aim to address the previous limitations of L1R-based vaccines, particularly their lower efficacy when used alone in primate models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.