Recombinant Variola virus Protein L5 (L5R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Target Names
L5R
Target Protein Sequence
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMHKRK IPDPIDRLRRANLACEDDKLMIYGLPWITTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR
Uniprot No.

Q&A

Basic Research Questions

  • What is the functional role of L5R protein in poxvirus biology?

    L5R protein serves as a critical component of the poxvirus cell entry/fusion apparatus. Research has demonstrated that L5 is required for entry of both intracellular and extracellular infectious forms of vaccinia virus. Experimental evidence shows that L5 is essential for virus replication, as virions lacking L5 can bind to cells but cannot deliver viral cores into the cytoplasm .

    Specifically, L5 functions in:

    • Core release into host cytoplasm

    • Low-pH-triggered cell-cell fusion

    • Cell-to-cell virus spread

    Mechanistically, L5 works in concert with three other membrane proteins (A21, A28, and H2) that collectively constitute the poxvirus entry/fusion complex .

  • How is the L5R gene conserved across different poxviruses?

    The L5R gene is remarkably conserved among all sequenced members of the Poxviridae family, occurring in both vertebrate and invertebrate poxviruses . This high degree of conservation underscores its essential function in viral replication. Multiple sequence alignment analysis of L5R orthologs across different poxvirus genera reveals:

    • Two conserved cysteine residues critical for protein function

    • An N-terminal hydrophobic domain that serves as a transmembrane anchor

    • Conservation across diverse poxvirus genera including Orthopoxvirus (vaccinia, variola), Leporipoxvirus, Capripoxvirus, and others

    The conservation pattern suggests strong evolutionary pressure to maintain this protein's structure and function, despite having no recognized homologs outside the poxvirus family .

  • What are the expression characteristics of L5 during viral infection?

    L5 exhibits expression kinetics typical of viral late proteins. Key characteristics include:

    • Expression begins approximately 6 hours post-infection and increases until 24 hours

    • Expression requires viral DNA replication, as demonstrated by inhibition studies with 1-β-d-arabinofuranosylcytosine (AraC)

    • L5 synthesis is regulated by a late promoter, evidenced by the presence of the late promoter consensus motif upstream of the L5R open reading frame

    When tagged with V5 epitope and analyzed by Western blotting, L5 appears as a 15-kDa protein consistent with its predicted molecular mass . Late expression timing correlates with L5's role in viral assembly and maturation rather than early events in infection.

Advanced Research Questions

  • What structural and biochemical characteristics define L5 protein?

    L5 protein has several key structural and biochemical features:

    FeatureCharacteristicExperimental Evidence
    Size15 kDa proteinWestern blot analysis
    Membrane topologyN-terminal transmembrane anchor with C-terminal domain exposed on virion surfaceTrypsin sensitivity and biotinylation studies
    Disulfide bondingSingle intramolecular disulfide bondMobility shift analysis with AMS treatment
    Membrane associationReleased from virions only with both NP-40 detergent and dithiothreitolVirion fractionation studies
    Surface exposureC-terminal domain accessible on intact virionsTrypsin cleavage pattern analysis

    The disulfide bond in L5 is formed by the vaccinia virus-encoded cytoplasmic redox pathway involving three oxidoreductases (E10, A2.5, and G4) . When this pathway is disrupted, as in the vE10i conditional mutant without inducer, L5 remains in a reduced state, confirming the requirement of this specialized viral pathway for proper L5 folding .

  • What experimental approaches can be used to study the role of L5 in viral entry?

    Several complementary approaches have proven effective:

    • Conditional lethal mutants: Constructing viruses where L5 expression depends on an inducer (e.g., IPTG) allows controlled study of its function

    • Core release assays: Measuring viral RNA synthesis following infection as a proxy for successful core delivery to cytoplasm

    • Immunofluorescence microscopy: Visualizing viral cores in the cytoplasm using antibodies against core proteins like A4

    • Fusion assays: Assessing cell-cell fusion following low-pH treatment to evaluate fusion activity

    • Comparative studies: Analyzing virions with and without L5 for morphological and functional differences

    A particularly informative approach involves differential analysis of virions produced in the presence (+L5) or absence (-L5) of inducer. These virions can be purified and compared for specific infectivity, protein composition, and ability to bind cells, deliver cores, and mediate fusion .

  • How does the virus-encoded redox pathway contribute to L5 function?

    The vaccinia virus-encoded redox pathway is essential for L5 function through proper disulfide bond formation. Methodological approaches to study this include:

    1. Redox state analysis: Using alkylating agents (AMS or NEM) that react with free thiols and cause mobility shifts during SDS-PAGE analysis

    2. Conditional mutant studies: Using vE10i mutant viruses to demonstrate how disruption of the redox pathway affects L5 structure

    3. Transmembrane protein expression systems: Employing specialized expression systems that maintain the oxidizing environment needed for proper folding

    Experimental evidence shows that in cells infected with vE10i (lacking E10 oxidoreductase function) in the absence of inducer, L5 remains completely reduced. This is visualized as a complete mobility shift upon alkylation with AMS . This finding confirms that the specialized vaccinia virus redox system, rather than host cell machinery, is required for proper L5 disulfide formation.

  • What is the relationship between L5 and other components of the poxvirus entry complex?

    L5 functions as part of a multiprotein complex necessary for viral entry. Key methodological approaches for studying these relationships include:

    • Comparative phenotype analysis: Comparing conditional lethal mutants of L5R, A21, A28, and H2 genes

    • Co-immunoprecipitation: Detecting physical interactions between complex components

    • Proximity labeling techniques: Identifying proteins in close proximity during entry

    • Cryo-electron microscopy: Visualizing the structural arrangement of entry complex components

    Research findings indicate that the phenotype of L5R conditional lethal mutant is identical to that of mutants in which expression of A21, A28, and H2 genes is repressed . All four proteins appear to function in the same pathway, as virions lacking any one of these components can bind to cells but fail to deliver cores into the cytoplasm or mediate fusion events .

  • How can conditional lethal mutants of L5R be constructed for functional studies?

    Construction of conditional lethal mutants involves a sophisticated experimental approach:

    1. Repressor-operator system design: Using E. coli lac repressor/operator system integrated into vaccinia virus genome

    2. Recombinant PCR for construct generation: Creating a PCR product with:

      • L5R ORF under control of a lac operator-regulated T7 promoter

      • Adjacent marker gene (e.g., EGFP) under control of a synthetic early-late promoter

      • Flanking sequences (~650 bp) for homologous recombination

    3. Transfection and selection: Transfecting the construct into cells infected with vT7LacOI virus

    4. Plaque purification: Multiple rounds of plaque purification in the presence of inducer (IPTG)

    5. Verification: Confirming genomic arrangements by PCR and sequencing

    The resulting virus (e.g., vV5-L5i) requires IPTG for L5 expression and exhibits a conditional-lethal phenotype where cell-to-cell virus spread and formation of infectious progeny are dependent on the inducer .

Methodological Considerations

  • What are the critical considerations for expressing and purifying recombinant L5 protein?

    Successful expression and purification of L5 requires careful attention to several factors:

    Expression SystemAdvantagesChallengesSpecial Considerations
    E. coliHigh yield, simplicityMay lack proper foldingRequires specialized folding protocols
    BaculovirusPost-translational modificationsMore complex systemBetter for membrane proteins
    Mammalian cellsNative-like foldingLower yieldPreferred for functional studies
    Cell-free expressionRapid productionMay lack chaperonesUseful for initial screening

    Critical methodological considerations include:

    1. Tag selection: N-terminal His tags are commonly used for L5 purification

    2. Disulfide bond formation: Expression conditions must facilitate proper disulfide formation

    3. Membrane protein solubilization: Appropriate detergents must be selected

    4. Quality control: SDS-PAGE analysis under reducing and non-reducing conditions to verify disulfide bond formation

    5. Storage conditions: Optimal storage at -20°C or -80°C to maintain stability

    Commercial recombinant L5 preparations typically achieve ≥85% purity as determined by SDS-PAGE .

  • How can researchers evaluate the contribution of L5 to membrane fusion events?

    Several methodological approaches can be employed:

    1. Low-pH fusion assays:

      • Fusion from within: Infecting cells with virus, then exposing to low pH

      • Fusion from without: Binding virus to cells at 4°C, then inducing fusion with low pH

      • Quantification: Counting multinucleated syncytia or using reporter-based fusion assays

    2. Core entry visualization:

      • Infecting cells in the presence of cycloheximide (prevents viral early gene expression)

      • Fixing and staining at various timepoints

      • Using antibodies against viral core proteins (e.g., A4) and membrane proteins (e.g., L1)

      • Confocal microscopy analysis to distinguish bound virions from internalized cores

    3. Viral RNA synthesis assays:

      • Measuring viral early gene transcription as evidence of successful core delivery

      • Northern blotting with labeled DNA probes complementary to viral early genes (e.g., C11R, E9L)

      • Comparing RNA levels in cells infected with +L5 versus -L5 virions

    Research with L5-deficient virions demonstrates that they cannot mediate low-pH-triggered cell-cell fusion from within or without, confirming L5's critical role in the fusion process .

  • What approaches can be used to study the membrane topology of L5?

    Determining the membrane topology of L5 requires multiple complementary techniques:

    1. Protease protection assays:

      • Treating intact virions with trypsin

      • Analyzing cleavage patterns by Western blotting

      • Identifying protected fragments using domain-specific antibodies

    2. Surface biotinylation:

      • Using membrane-impermeable biotinylation reagents

      • Capturing biotinylated proteins with streptavidin

      • Detecting L5 in biotinylated fractions by immunoblotting

    3. Epitope accessibility studies:

      • Introducing epitope tags at various positions

      • Assessing accessibility by antibody binding to intact virions

      • Using permeabilized vs. non-permeabilized conditions to distinguish surface-exposed regions

    Research using these approaches has demonstrated that L5 is anchored in the viral membrane by its N-terminal hydrophobic domain with the large C-terminal fragment exposed on the virion surface . The V5-tagged N-terminal segment remains protected beneath the membrane, while the C-terminal domain is accessible to surface proteases and biotinylation reagents .

  • How can researchers design experiments to compare L5 function across different poxviruses?

    Comparative studies of L5 across poxviruses can employ several strategies:

    1. Sequence-based approaches:

      • Multiple sequence alignment of L5 orthologs from different poxviruses

      • Identification of conserved domains and critical residues

      • Phylogenetic analysis to understand evolutionary relationships

    2. Functional complementation:

      • Replacing L5R in vaccinia virus with orthologs from other poxviruses

      • Testing if heterologous L5 proteins can rescue L5-deficient vaccinia virus

      • Quantifying complementation efficiency through plaque formation and viral yield

    3. Structural biology approaches:

      • Comparing crystal structures of L5 from different poxviruses

      • Analyzing conservation of key structural elements like the disulfide bond

      • Identifying structural features that correlate with host range

    4. Chimeric protein studies:

      • Creating chimeric L5 proteins with domains from different poxviruses

      • Identifying which regions confer species-specific functions

      • Mapping functional domains through systematic domain swapping

    The high conservation of L5 across all sequenced members of Poxviridae suggests these comparative approaches could yield insights into both conserved mechanisms and species-specific adaptations in poxvirus entry .

Experimental Design Questions

  • What are the most effective methods for monitoring L5 protein expression during infection?

    Several complementary techniques can be employed:

    1. Western blotting with time course analysis:

      • Infecting cells and collecting samples at different time points (0-24h)

      • Including conditions with DNA replication inhibitors (e.g., AraC)

      • Using epitope-tagged L5 (e.g., V5-L5) or L5-specific antibodies

      • Quantifying band intensity to plot expression kinetics

    2. Immunofluorescence microscopy:

      • Fixing infected cells at various time points

      • Co-staining with markers for different viral structures

      • Tracking L5 localization throughout infection

    3. Quantitative RT-PCR for transcript analysis:

      • Designing primers specific to L5R mRNA

      • Measuring transcript levels throughout infection

      • Correlating with protein expression data

    4. Pulse-chase labeling:

      • Using radioactive amino acids or click chemistry approaches

      • Determining synthesis rates and protein stability

    Studies have shown that V5-tagged L5 appears at approximately 6 hours post-infection, increases until 24 hours, and is not detected when viral DNA replication is inhibited by AraC . These characteristics confirm L5's classification as a late viral protein.

  • How can researchers investigate the interaction between L5 and host cell factors?

    Several methodological approaches can be employed:

    1. Affinity purification coupled with mass spectrometry:

      • Expressing tagged L5 in host cells

      • Performing pulldowns under various conditions

      • Identifying co-purifying host proteins by mass spectrometry

      • Validating interactions by reciprocal co-immunoprecipitation

    2. Proximity labeling techniques:

      • Fusing L5 to BioID or APEX2 enzymes

      • Allowing in vivo biotinylation of proximal proteins

      • Purifying biotinylated proteins for mass spectrometry

    3. Yeast two-hybrid screening:

      • Using L5 as bait against host cDNA libraries

      • Focusing on extracellular domain for potential receptor interactions

    4. CRISPR/Cas9 screening:

      • Conducting genome-wide knockout screens for host factors

      • Identifying cellular genes that alter infectivity of L5-dependent viruses

      • Comparing screens with wild-type versus L5-deficient viruses

    Current research has established that while L5-deficient virions can bind to cells, they cannot deliver cores to the cytoplasm . This suggests that L5 may interact with specific host factors necessary for membrane fusion or pore formation rather than initial attachment receptors.

  • What approaches can be used to develop inhibitors targeting L5 protein function?

    Structure-based inhibitor development could employ several strategies:

    1. High-throughput screening approaches:

      • Developing assays measuring L5-dependent fusion

      • Screening compound libraries for inhibitors

      • Conducting secondary validation assays

    2. Structure-based drug design:

      • Using L5 crystal structure data

      • Employing computational docking to identify binding pockets

      • Designing small molecules to interfere with L5 function

    3. Antibody-based inhibitors:

      • Generating monoclonal antibodies targeting L5 functional domains

      • Screening for neutralizing activity

      • Performing epitope mapping to identify critical binding regions

    4. Peptide inhibitors:

      • Designing peptides mimicking L5 interaction interfaces

      • Testing competitive inhibition of L5-dependent processes

      • Optimizing for stability and cell penetration

    As demonstrated in studies with conditional L5 mutants, disruption of L5 function prevents viral entry and cell-to-cell spread while allowing virus assembly to proceed normally . This makes L5 an attractive target for antiviral development against poxviruses, as inhibitors would block infection spread without affecting uninfected cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.