Recombinant Variovorax paradoxus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Vapar_3500; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Variovorax paradoxus (strain S110)
Target Names
nuoK
Target Protein Sequence
MTLTLGHFLSLGAMLFALSVIGIFLNRKNLIVLLMAIELMLLAVNMNFVAFSYYLGDMHG QIFVFFILTVAAAESAIGLALLVLLFRNKSNINVDELNSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are moved across the cytoplasmic membrane, conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Variovorax paradoxus NADH-quinone oxidoreductase subunit K (nuoK)?

The NADH-quinone oxidoreductase subunit K (nuoK) is a protein component of complex I of the respiratory chain in Variovorax paradoxus. Specifically, it is one of the membrane-embedded subunits of this enzyme complex, which is responsible for electron transport from NADH to ubiquinone in the bacterial respiratory chain. In V. paradoxus strain S110, nuoK is encoded by the Vapar_3500 locus and consists of 102 amino acids . The protein functions as part of the larger NADH dehydrogenase I complex (also called NDH-1), which is homologous to mitochondrial complex I in eukaryotes .

What role does NADH-quinone oxidoreductase play in V. paradoxus metabolism?

NADH-quinone oxidoreductase plays a crucial role in the energy metabolism of V. paradoxus, contributing to its remarkable metabolic versatility. As part of the respiratory chain, this enzyme complex:

  • Catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q)

  • Couples this electron transfer to proton translocation across the membrane

  • Contributes to the generation of a proton gradient used for ATP synthesis

  • Supports both heterotrophic and autotrophic lifestyles

The metabolic diversity enabled by this and other respiratory complexes allows V. paradoxus to thrive in various environmental conditions and engage in symbiotic relationships with plants and other microorganisms . The S110 strain in particular has evolved into a highly adaptable microorganism with diverse metabolic capabilities for both independent survival and symbiotic lifestyles .

How does V. paradoxus nuoK compare structurally and functionally to similar proteins in other bacterial species?

The nuoK subunit in V. paradoxus shows structural and functional similarities to homologous proteins in other bacterial species, but with some notable differences:

SpeciesProteinSimilarity to V. paradoxus nuoKFunctional Differences
V. paradoxus S110NuoKReference sequence (102 aa)Part of a system enabling metabolic versatility
Saccharomyces cerevisiaeNdi1PFunctional analog but structurally differentSingle-subunit NADH dehydrogenase vs. multi-subunit complex
Other Variovorax speciesNuoKVariable similarity based on ANI*Function correlates with genome architecture variations

*ANI: Average Nucleotide Identity

While the core function of electron transport is conserved, the nuoK protein in V. paradoxus likely contributes to this organism's remarkable metabolic flexibility, allowing it to biodegrade both biogenic compounds and anthropogenic contaminants . Analysis of genomic data suggests that there is significant variation even within the Variovorax genus, with several organisms classified as V. paradoxus falling below the species delineation cutoff when compared to others of the same species .

What experimental approaches are most effective for studying nuoK's role in the NADH-quinone oxidoreductase complex?

To investigate nuoK's role within the NADH-quinone oxidoreductase complex, researchers should consider these methodological approaches:

  • Site-directed mutagenesis: Introducing specific mutations in the nuoK gene to assess their impact on complex assembly and function. Target conserved residues identified through sequence alignments.

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with antibodies against nuoK or other subunits

    • Crosslinking experiments followed by mass spectrometry

    • Bacterial two-hybrid assays to identify interacting partners

  • Functional complementation: Express V. paradoxus nuoK in complex I-deficient systems, similar to experiments demonstrating that yeast Ndi1P can functionally replace complex I in mammalian cells . This approach can help elucidate whether nuoK alone can restore specific functions.

  • Respiratory chain activity assays: Compare NADH oxidation rates and sensitivity to complex I inhibitors (such as rotenone and pyridaben) in wild-type versus nuoK-mutant strains .

  • Membrane topology analysis: Determine the orientation and membrane insertion of nuoK using reporter fusion constructs or accessibility assays.

These approaches should be complementary to provide a comprehensive understanding of nuoK's structural and functional roles within the complex.

How can researchers optimize the expression and purification of recombinant V. paradoxus nuoK?

The expression and purification of membrane proteins like nuoK presents significant challenges. Based on available data and standard protocols for membrane proteins, we recommend:

Expression System Selection:

  • E. coli-based expression systems with specialized strains (C41/C43) designed for membrane proteins

  • Consider using the pBBR-based vector system, which has been successfully used with V. paradoxus EPS

  • Explore arabinose-inducible promoters, which have shown success in controlling expression in V. paradoxus

Expression Optimization:

  • Test different induction conditions (temperature, inducer concentration, time)

  • Use fusion tags that aid in membrane protein folding (e.g., MBP, SUMO)

  • Consider co-expression with chaperones to improve folding

Purification Protocol:

  • Solubilization with appropriate detergents (n-dodecyl-β-D-maltoside, digitonin, or lauryl maltose neopentyl glycol)

  • Affinity chromatography using the histidine tag or other fusion tags

  • Size exclusion chromatography to isolate properly folded protein

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Activity Verification:

  • NADH oxidation assays using artificial electron acceptors

  • Reconstitution into liposomes to assess native-like activity

Researchers should monitor for the formation of different colony phenotypes during expression, as observed with other recombinant proteins in V. paradoxus, which may affect protein yield and quality .

What approaches can be used to study the genomic context of the nuoK gene in different V. paradoxus strains?

The genomic context of nuoK varies across V. paradoxus strains due to the significant heterogeneity in genome architecture within this genus. Researchers can employ these methodologies:

  • Comparative Genomic Analysis:

    • Perform Average Nucleotide Identity (ANI) analysis across Variovorax genomes to evaluate relatedness

    • Compare the genetic neighborhood of nuoK across different strains to identify conserved gene clusters

    • Analyze G+C content surrounding the nuoK gene to identify potential horizontal gene transfer events

  • Long-read Sequencing:

    • Utilize MinION or similar long-read sequencing technologies for hybrid assemblies, as demonstrated in recent Variovorax genomic studies

    • This approach is particularly important for resolving complex genomic architectures, including plasmids, megaplasmids, and chromids that might contain nuoK or influence its regulation

  • Replicon Analysis:

    • Determine whether nuoK is encoded on the chromosome or on secondary replicons

    • Investigate the distribution of respiratory chain components across different replicons

    • Analyze ParB homology to identify evolutionary relationships between replicons that may contain nuoK

  • Synteny Analysis:

    • Map the conservation of gene order surrounding nuoK across different strains

    • Identify potential operon structures that include nuoK

The recent completion of multiple Variovorax genome assemblies has revealed extensive heterogeneity in genome structure, with evidence of plasmid integration events and complex replicon dynamics . This genome plasticity may influence nuoK expression and function across different strains.

How can researchers investigate the role of nuoK in V. paradoxus adaptation to different environmental conditions?

Given V. paradoxus' remarkable adaptability to various environmental conditions , investigating nuoK's role in this adaptation requires a multi-faceted approach:

  • Transcriptomic Analysis:

    • RNA-seq to measure nuoK expression under different growth conditions (varying carbon sources, oxygen levels, pH, temperature)

    • Identify co-expressed genes to understand the regulatory networks involving nuoK

  • Growth and Fitness Studies:

    • Compare growth rates of wild-type and nuoK mutant strains under different conditions

    • Competition assays between nuoK variants to assess fitness advantages

    • Biofilm formation assays to evaluate the role of nuoK in surface colonization

  • Metabolic Phenotyping:

    • Measure respiration rates and membrane potential under different environmental conditions

    • Use Biolog plates or similar technology to assess metabolic capabilities

    • Quantify NADH/NAD+ ratios to evaluate the impact of nuoK variations on redox balance

  • Plant-Microbe Interaction Studies:

    • Assess the impact of nuoK mutations on V. paradoxus' ability to colonize plant roots

    • Measure plant growth promotion effects with wild-type versus nuoK mutant strains

    • Analyze rhizosphere competence and persistence

  • Experimental Evolution:

    • Evolve V. paradoxus under selection pressure and sequence nuoK to identify adaptive mutations

    • Engineer identified mutations into the reference strain to confirm their adaptive value

This integrated approach will help elucidate how nuoK contributes to V. paradoxus' ability to "survive in ever-changing environmental conditions" and engage in "mutually beneficial interactions with both bacteria and plants" .

What bioinformatic tools and approaches are most appropriate for analyzing evolutionary conservation of nuoK?

To analyze the evolutionary conservation of nuoK across Variovorax species and related bacteria, researchers should employ these bioinformatic tools and approaches:

  • Sequence Alignment Tools:

    • MUSCLE or MAFFT for multiple sequence alignment of nuoK homologs

    • HMMER for profile-based searches to identify distant homologs

    • Jalview for visualization and analysis of conserved motifs

  • Phylogenetic Analysis:

    • RAxML or IQ-TREE for maximum likelihood phylogenetic tree construction

    • MrBayes for Bayesian phylogenetic inference

    • FigTree or iTOL for visualization and annotation of phylogenetic trees

    • Comparison with species trees to identify potential horizontal gene transfer events

  • Selective Pressure Analysis:

    • PAML or HyPhy to calculate dN/dS ratios and identify sites under positive selection

    • FUBAR for detecting sites evolving under pervasive diversifying selection

    • MEME for detecting episodic selection at individual sites

  • Structural Bioinformatics:

    • ConSurf for mapping conservation onto predicted protein structures

    • I-TASSER or AlphaFold2 for structural prediction of nuoK

    • CAVER for prediction of channels and tunnels in the protein structure

  • Comparative Genomics:

    • Average Nucleotide Identity (ANI) analysis, which has revealed that organisms classified as V. paradoxus may fall below species delineation cutoffs

    • Analysis of synteny and gene neighborhood conservation

When interpreting the results, researchers should consider the "murky" species delineation within the Variovorax genus and how this might affect interpretation of nuoK conservation patterns.

How can researchers effectively design experiments to assess the impact of nuoK mutations on complex I function?

Designing experiments to assess the impact of nuoK mutations requires systematic approaches targeting different aspects of complex I function:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues identified through sequence analysis

    • Create alanine scanning libraries across transmembrane domains

    • Generate mutations mimicking naturally occurring variants found in different Variovorax strains

    • Design chimeric proteins with nuoK regions from different species

  • Functional Assays:

    • NADH oxidation assays with artificial electron acceptors

    • Oxygen consumption measurements using high-resolution respirometry

    • Membrane potential measurements using potential-sensitive dyes

    • Superoxide production assays to assess electron leakage

    • Sensitivity testing to complex I inhibitors like rotenone and pyridaben

  • Structural Impact Assessment:

    • Blue native PAGE to analyze complex assembly

    • Crosslinking studies to evaluate subunit interactions

    • Thermal shift assays to assess complex stability

    • Protease sensitivity assays to detect conformational changes

  • In vivo Phenotyping:

    • Growth curve analysis under different carbon sources

    • Competitive fitness assays

    • Metabolomic profiling to detect metabolic rewiring

    • Stress resistance tests (oxidative, temperature, pH)

  • Complementation Studies:

    • Express mutant nuoK in a nuoK-deficient background

    • Assess rescue of phenotypes by varying expression levels

    • Consider heterologous complementation in other bacterial species

  • Data Analysis Framework:

    • Establish clear controls (positive, negative, and wild-type)

    • Use multiple biological and technical replicates

    • Apply appropriate statistical tests (ANOVA, t-tests)

    • Consider multivariate analysis for complex phenotypic data

This experimental design framework allows for comprehensive characterization of nuoK's role in complex I function and the impact of specific residues on various aspects of NADH-quinone oxidoreductase activity.

How might recombinant V. paradoxus nuoK be used as a tool in neurodegenerative disease research?

The potential application of recombinant V. paradoxus nuoK in neurodegenerative disease research stems from the relationship between complex I dysfunction and conditions like Parkinson's and Huntington's disease . Several research approaches are promising:

  • Therapeutic Development Strategy:

    • Similar to how the single-subunit NADH dehydrogenase from S. cerevisiae (Ndi1P) has been shown to functionally replace complex I in mammalian cells , researchers could investigate whether expressing specific V. paradoxus nuoK variants can rescue complex I deficiencies

    • Explore the development of recombinant adeno-associated virus vectors carrying modified nuoK genes

    • Test whether the expressed protein confers resistance to complex I inhibitors in neuronal cell lines

  • Disease Modeling Applications:

    • Use recombinant nuoK to create cellular models with controlled levels of complex I dysfunction

    • Study the effects of different nuoK variants on mitochondrial function in neuronal cells

    • Investigate the impact on neurite outgrowth and neuronal maturation

  • Structural and Functional Studies:

    • Compare the structure and function of V. paradoxus nuoK with human complex I subunits

    • Identify critical residues that could be targets for drug development

    • Use nuoK as a model system to screen for compounds that modulate complex I activity

  • Experimental Design Considerations:

    • Express nuoK in dopaminergic cell lines like rat PC12 and mouse MN9D

    • Assess resistance to known complex I inhibitors such as rotenone and pyridaben

    • Monitor morphological maturation through neurite outgrowth assays

    • Evaluate functional activity through enzymatic assays

This approach builds on the demonstrated success of single-subunit NADH dehydrogenase as a replacement for complex I in mammalian cells, offering potential therapeutic applications for neurodegenerative disorders associated with complex I dysfunction .

What methods can be used to study the integration of nuoK into the membrane and its interaction with lipids?

Studying the membrane integration and lipid interactions of nuoK requires specialized techniques for membrane protein analysis:

  • Membrane Topology Determination:

    • PhoA/LacZ fusion analysis to map transmembrane segments

    • Cysteine scanning mutagenesis with accessibility studies

    • Protease protection assays to identify protected domains

    • GFP fusion analysis to determine orientation in the membrane

  • Lipid Interaction Studies:

    • Reconstitution in liposomes with varying lipid compositions

    • Förster resonance energy transfer (FRET) between labeled nuoK and fluorescent lipids

    • Native mass spectrometry to identify co-purifying lipids

    • Molecular dynamics simulations of nuoK in various lipid environments

  • Structural Analysis in Membrane Environment:

    • Cryo-electron microscopy of nuoK in nanodiscs or liposomes

    • Solid-state NMR spectroscopy for structural determination in native-like environments

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

    • EPR spectroscopy with site-directed spin labeling to measure distances and dynamics

  • Biophysical Characterization:

    • Circular dichroism spectroscopy to assess secondary structure in different lipid environments

    • Differential scanning calorimetry to measure thermal stability

    • Surface plasmon resonance to study protein-lipid interactions

    • Atomic force microscopy to visualize nuoK organization in membranes

  • Functional Assays in Different Lipid Environments:

    • Activity measurements in liposomes with varying lipid compositions

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Patch-clamp experiments with reconstituted proteins

These methodologies can help elucidate how nuoK's integration into the membrane influences its function within the NADH-quinone oxidoreductase complex and how different lipid environments may affect its activity and stability.

What are the most promising areas for future research on V. paradoxus nuoK and its role in bacterial metabolism?

Based on current knowledge and gaps in understanding, several promising research directions emerge:

  • Metabolic Engineering Applications:

    • Exploring how nuoK modifications could enhance V. paradoxus' already impressive capabilities for biodegradation of anthropogenic contaminants

    • Engineering nuoK variants with improved electron transfer efficiency for bioremediation applications

    • Developing V. paradoxus strains with modified respiratory chains for biofertilizer applications

  • Evolutionary Biology:

    • Investigating how nuoK diversity contributes to the "murky" species delineation within Variovorax

    • Studying how horizontal gene transfer and replicon dynamics have shaped nuoK evolution

    • Exploring the correlation between nuoK sequence variation and ecological niches

  • Structural Biology:

    • Determining high-resolution structures of V. paradoxus complex I with focus on nuoK

    • Mapping the conformational changes during electron transport

    • Identifying key residues for proton translocation

  • Systems Biology:

    • Integrating nuoK function into genome-scale metabolic models of V. paradoxus

    • Exploring how nuoK expression is regulated in different environmental conditions

    • Investigating how nuoK contributes to V. paradoxus' symbiotic relationships with plants

  • Synthetic Biology:

    • Designing minimal respiratory chains with engineered nuoK variants

    • Creating hybrid systems combining features of bacterial and mitochondrial complex I

    • Developing biosensors based on nuoK function for environmental monitoring

The genomic plasticity of Variovorax provides a rich foundation for studying how respiratory chain components like nuoK adapt to different ecological niches and contribute to this organism's remarkable metabolic versatility and symbiotic capabilities .

How might genomic heterogeneity within Variovorax species impact studies of nuoK function?

The extensive genomic heterogeneity observed in Variovorax species has significant implications for nuoK research:

  • Experimental Design Considerations:

    • When studying nuoK, researchers must carefully specify which strain of V. paradoxus they are using, as ANI analysis shows that several organisms classified as V. paradoxus fall below species delineation cutoffs

    • Comparative studies across multiple strains are essential to capture functional diversity

    • The presence of multiple replicons (chromosomes, megaplasmids, chromids) may affect nuoK copy number and expression patterns

  • Functional Variation:

    • Different V. paradoxus strains may show varying nuoK functions depending on their genomic context

    • The location of nuoK (chromosome vs. secondary replicon) may affect its regulation

    • Plasmid integration events, such as those identified in NFACC27 , could lead to altered nuoK expression

  • Methodological Approaches:

    • Long-read sequencing technologies are crucial for accurately determining the genomic context of nuoK

    • G+C content analysis can help identify whether nuoK has been acquired through horizontal gene transfer

    • Protein-protein interaction studies should consider strain-specific variation in complex I composition

  • Data Interpretation Challenges:

    • Phenotypic differences observed between strains may be due to nuoK variations or other genomic differences

    • Functional complementation experiments must account for potential incompatibilities between nuoK variants

    • Evolutionary analyses must consider the complex history of replicon fusion and horizontal gene transfer

The "extensive heterogeneity in genome architecture" within Variovorax creates both challenges and opportunities for nuoK research, offering a natural laboratory for studying how respiratory chain components evolve and adapt in different genomic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.