Recombinant Variovorax paradoxus Probable intracellular septation protein A (Vapar_2937)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Vapar_2937 is annotated as a probable intracellular septation protein, implicating it in bacterial cell division. Experimental data indicate:

  • Role in Septation: Likely facilitates intracellular membrane partitioning during cell division, though direct mechanistic studies are pending .

  • Genetic Context: Encoded by the Vapar_2937 gene (UniProt ID: C5CNT0), which is conserved in Variovorax species .

  • Interactions: Predicted to cooperate with other division proteins (e.g., FtsZ), though interactome data remain unpublished .

Research Applications

This recombinant protein is primarily used in:

  • Mechanistic Studies: Investigating bacterial cell division and septation dynamics .

  • Antibiotic Development: As a potential target for disrupting biofilm formation or bacterial proliferation .

  • Structural Biology: Enabling crystallization or Cryo-EM studies to resolve septation machinery .

Recent RNA-Seq analyses of V. paradoxus growth phases (log, stationary, biofilm) highlight differential expression of cell division genes, indirectly supporting Vapar_2937’s regulatory role .

Challenges and Limitations

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; single-use aliquots are advised .

  • Functional Validation: No in vitro enzymatic assays or knockout studies confirming its septation role are publicly available .

  • Expression Variability: Batch-to-batch differences in E. coli-derived protein purity (85–90%) may affect reproducibility .

Future Directions

  1. Mechanistic Elucidation: High-resolution structural studies to map interaction sites with divisome components .

  2. Genetic Knockout Models: Generating V. paradoxus ΔVapar_2937 strains to assess septation defects .

  3. Biotechnological Adaptation: Leveraging its properties for synthetic biology applications, such as engineered cell division systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Vapar_2937; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Variovorax paradoxus (strain S110)
Target Names
Vapar_2937
Target Protein Sequence
MKLILDFFPILLFFGAYKLADIYTATGVLMAATVLQMGIIYAMERKLQAMQKATLVLILL FGTLTLVLHDDRFIKWKPTVLYGAMAIALAVALWALKKNFLKMLLGSQLQLPDRIWGRLN VAWIGYCLFMAAINGYVAAYFTTEAWVNFKLWGYVFPIVFLVAQGLYISPHLKNDEPSV
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Variovorax paradoxus and why is it significant for microbiological research?

Variovorax paradoxus is a metabolically versatile aerobic bacterium belonging to the subclass of Proteobacteria. It has gained research attention due to its diverse metabolic capabilities, including biodegradation of both biogenic compounds and anthropogenic contaminants. V. paradoxus engages in mutually beneficial interactions with both bacteria and plants, making it an ideal model for studying microbe-microbe and microbe-plant interactions . The complete genome sequence of V. paradoxus S110 consists of 6,754,997 bp with 6,279 predicted protein-coding sequences distributed across two circular chromosomes . This metabolic diversity enables it to thrive in diverse environmental conditions and function as a plant growth-promoting rhizobacterium (PGPR) .

What is the predicted function of Vapar_2937 protein?

Vapar_2937 is annotated as a probable intracellular septation protein A, implying its involvement in bacterial cell division processes. Current experimental data suggests it likely plays a role in facilitating intracellular membrane partitioning during cell division. The protein is predicted to interact with other division proteins such as FtsZ, though comprehensive interactome data remains unpublished. As a component of the cell division machinery, Vapar_2937 represents a potential target for disrupting biofilm formation or bacterial proliferation in the development of novel antibiotics.

How does Vapar_2937 expression change during biofilm formation?

Transcriptome analysis using paired-end strand-specific RNA-seq has revealed differential gene expression patterns associated with biofilm formation in V. paradoxus. While specific data for Vapar_2937 is not explicitly detailed in the search results, RNA-Seq analyses of V. paradoxus growth phases (logarithmic growth, stationary phase, and biofilm) have highlighted differential expression of cell division genes . These analyses provide indirect evidence supporting Vapar_2937's potential regulatory role in the transition between planktonic and biofilm growth states. The most highly upregulated biofilm-specific genes in V. paradoxus are associated with RNA degradosome components, suggesting that RNA stability may be a key regulatory mechanism during biofilm formation .

What experimental approaches are recommended for studying Vapar_2937 function?

Based on current research strategies, the following experimental approaches are recommended for investigating Vapar_2937 function:

Experimental ApproachMethodologyExpected OutcomesLimitations
Structural BiologyX-ray crystallography or Cryo-EM studiesHigh-resolution structure to map interaction sites with divisome componentsMembrane proteins are challenging to crystallize
Gene KnockoutCRISPR-Cas9 or homologous recombination to generate ΔVapar_2937 strainsAssessment of septation defects and growth phenotypesMay be lethal if protein is essential
Protein-Protein InteractionBacterial two-hybrid or co-immunoprecipitationIdentification of interaction partners within divisomeMay miss transient interactions
Localization StudiesFluorescent protein fusions or immunofluorescenceSubcellular localization during different growth phasesTag may interfere with function
Transcriptomic AnalysisRNA-Seq comparing expression under different conditionsRegulatory networks associated with Vapar_2937Correlative rather than causative evidence

These methodologies should be selected based on specific research questions and available resources.

How does Vapar_2937 compare to homologous proteins in other bacterial species?

Vapar_2937 is also known as YciB (Inner membrane-spanning protein YciB) based on homology to proteins in other bacterial species . Comparisons with septation proteins across different bacterial taxa reveal both conserved and divergent features. While the specific comparison data is not provided in the search results, bioinformatic analyses suggest that Vapar_2937 has functional homologs in diverse bacterial lineages.

The protein appears to be part of a conserved set of cell division proteins that are widely distributed among bacteria, though specific mechanisms may vary between species. Interestingly, V. paradoxus biofilms have been noted to have "substantial regulatory and structural novelty" compared to other bacterial systems, suggesting that Vapar_2937 may function in ways that differ from its homologs in other species .

What are the optimal storage and handling conditions for recombinant Vapar_2937?

Recombinant Vapar_2937 requires specific storage and handling conditions to maintain stability and functionality:

  • Long-term storage: Store at -20°C or -80°C for extended preservation .

  • Working solution: Aliquot and store at 4°C for up to one week to avoid repeated freeze-thaw cycles .

  • Recommended buffer: Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Reconstitution protocol: Briefly centrifuge prior to opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Stability concerns: Repeated freezing and thawing significantly degrades activity and should be avoided .

For optimal results, the addition of 5-50% glycerol (final concentration) is recommended when preparing aliquots for long-term storage .

What expression systems are most effective for producing recombinant Vapar_2937?

Recombinant Vapar_2937 has been successfully expressed in E. coli expression systems with various purification tags. The most common approach involves:

  • Expression vector: Vectors containing strong promoters (T7, etc.) with N-terminal His-tag for purification .

  • Expression host: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)).

  • Induction conditions: IPTG induction with careful temperature control (typically 18-25°C) to prevent inclusion body formation.

  • Purification: Affinity chromatography using the His-tag, followed by size exclusion chromatography.

It's worth noting that batch-to-batch differences in E. coli-derived protein purity (typically 85–90%) may affect experimental reproducibility. Therefore, quality control measures such as SDS-PAGE analysis to confirm purity greater than 90% are recommended .

How might Vapar_2937 contribute to V. paradoxus biofilm formation?

V. paradoxus biofilms have been shown to have unique regulatory and structural characteristics compared to other bacterial systems . Transcriptome analysis has revealed that biofilm formation in V. paradoxus is accompanied by a large-scale change in transcript profile that differs significantly from the shift to stationary-phase growth, with 1711 transcripts uniquely and significantly altered in expression by more than twofold in biofilm cultures .

While the specific role of Vapar_2937 in biofilm formation has not been directly characterized, its function as a septation protein suggests potential involvement in cellular organization within biofilms. Interestingly, two small putative proteins in V. paradoxus (Varpa_0407 and Varpa_3832) are highly expressed specifically in biofilms and are predicted to be secreted DNA-binding proteins that may stabilize extracellular DNA as a component of the biofilm matrix . Future research could investigate potential interactions between Vapar_2937 and these biofilm-specific proteins.

What is the potential of Vapar_2937 as a target for antimicrobial development?

As a protein involved in bacterial cell division, Vapar_2937 represents a potential target for novel antimicrobial compounds. Several research directions show promise:

  • Structure-based drug design: High-resolution structural studies could enable the design of small molecule inhibitors targeting specific functional domains of Vapar_2937.

  • Peptide inhibitors: Developing peptides that interfere with Vapar_2937 interactions within the divisome complex.

  • Antibiofilm strategies: If Vapar_2937 plays a role in biofilm formation, inhibitors could potentially disrupt biofilm development, increasing susceptibility to conventional antibiotics.

  • Cross-species applications: If functional mechanisms are conserved, inhibitors might have broad-spectrum activity against multiple bacterial species.

The unique metabolic capabilities of V. paradoxus, including its roles in biodegradation and plant growth promotion, make understanding its essential cellular processes particularly valuable for both environmental and medical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.