Recombinant Variovorax paradoxus Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Variovorax paradoxus Probable Ubiquinone Biosynthesis Protein UbiB (UbiB)

Variovorax paradoxus is a metabolically versatile bacterium known for biodegrading various compounds and interacting beneficially with plants and other bacteria . Within V. paradoxus, the UbiB protein, specifically the recombinant full-length form, is a probable ubiquinone biosynthesis protein that is expressed in E. coli . It is tagged with histidine (His) to aid in purification and identification . UbiB is believed to regulate UbiI activity, which takes part in the aerobic coenzyme Q (ubiquinone) biosynthesis process .

Function and Significance

UbiB is involved in the ubiquinone biosynthesis pathway, which is crucial for producing ubiquinone (coenzyme Q) . Ubiquinone is a key component in the electron transport chain, essential for cellular respiration and ATP production . It acts as a redox-active molecule, transferring electrons between complexes in the respiratory chain . Ubiquinone also functions as an antioxidant, protecting cells from oxidative stress .

Ubiquinone Biosynthesis and Inhibition

Ubiquinone biosynthesis can be targeted to develop effective therapeutic strategies . For instance, atovaquone (AV) combats malaria by interfering with ubiquinol's binding to the mitochondrial bc1 complex in the parasite Plasmodium falciparum . This disruption inhibits ubiquinone redox recycling, which is vital for pyrimidine biosynthesis . Inhibitors like 4-nitrobenzoate (4-NB) can reduce ubiquinone biosynthesis by targeting UbiA enzymes, enhancing the efficacy of drugs like atovaquone .

Variovorax paradoxus in Biofilm Formation and Genetic Studies

V. paradoxus forms biofilms, complex microbial communities attached to surfaces, demonstrating a unique adaptation to environmental conditions . Transcriptome analysis reveals that biofilm formation in V. paradoxus involves significant changes in gene expression, differing from stationary-phase growth . Genes related to RNA stability and DNA-binding proteins are highly expressed in biofilms, suggesting their roles in regulating and stabilizing the biofilm matrix . Recombinant V. paradoxus strains expressing Green Fluorescent Protein (GFP) have been used to study gene expression control and phenotypic variations . These studies help in understanding the genetic and regulatory mechanisms in V. paradoxus, which can be applied in various biotechnological applications, including bioremediation and plant growth promotion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ubiB; Vapar_4126; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Variovorax paradoxus (strain S110)
Target Names
ubiB
Target Protein Sequence
MRRFYRGIFIVWVALRYGLDELVLTSFQKPWLRVVARIVSIGRNLDAPRGQRLREALERL GPIFVKFGQVLSTRRDLLPPDIADELAFLQDRVPPFPSAVAIATIERAFRRPVGDVFVQF DETPIASASIAQVHFATIRTDEGEVREVAVKVLRPSMRGVIEKDLALMAMMAGWVEKLSP DGKRLKPREVVGEFDKYLHDELDLVREAANAAQLRRNMASLELVLIPEMFWDFCHPEVIV MERMNGVPIAQLDRLRAAGVDIPKLARDGVTIFFTQVFRDGFFHADMHPGNIQVSLAPET FGRYISLDFGIIGTLTESDKEYLAQNFVAFFRRDYKRVAELHLESGWVPEGTRIDELEGA IRTVCEPYFDRPLKEISLGMVLMRLFQTSRRFHVEIQPQLVLLQKTLLNIEGLGRQLDPE LDLWHTAKPFLEKWMVDQIGPKKLFQQLKAEAPRYAKLLPELPRLLHDFLENRPADHRRE LLELLAAQKRTNRLLQTIIYGGIGFVLGLLAMQLLVRVRLF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the UbiB protein in Variovorax paradoxus and what is its genomic context?

UbiB is a probable ubiquinone biosynthesis protein in Variovorax paradoxus that plays a crucial role in the electron transport chain by facilitating ubiquinone (coenzyme Q) production. In V. paradoxus EPS, the gene is located on its circular chromosome, which spans approximately 6.55 million base pairs . The genome of V. paradoxus EPS contains 5,952 protein-coding genes and 67 RNA genes . Based on comparative genomics, the UbiB protein in V. paradoxus likely functions as part of the aerobic respiratory pathway, essential for this organism's diverse metabolic capabilities that enable both independent survival and symbiotic lifestyles .

What is the relationship between UbiB and V. paradoxus metabolic versatility?

Variovorax paradoxus is renowned for its exceptional metabolic versatility, capable of utilizing a wide range of natural compounds and xenobiotics . The UbiB protein, as part of the ubiquinone biosynthesis pathway, contributes to this versatility by ensuring efficient energy production through aerobic respiration. This efficiency is particularly important given that V. paradoxus has evolved multiple metabolic features supporting both autotrophic and heterotrophic lifestyles . The organism's ability to thrive in diverse environments, from soil to plant interiors, depends partly on efficient energy metabolism systems, of which UbiB is a critical component. The complete genome sequence of V. paradoxus S110 reveals 6,279 predicted protein-coding sequences across two circular chromosomes, many of which contribute to its metabolic flexibility .

How does UbiB expression change under different growth conditions in V. paradoxus?

While specific UbiB expression data is not directly provided in the search results, transcriptome profiling of V. paradoxus EPS under different growth conditions reveals substantial regulatory changes between planktonic and biofilm growth modes . RNA-seq analysis identified 1,711 transcripts uniquely and significantly altered in biofilm cultures compared to planktonic growth . Given UbiB's role in energy metabolism, its expression likely varies based on growth conditions, potentially upregulated during aerobic growth on specific carbon sources or under conditions requiring high metabolic activity. V. paradoxus demonstrates different physiologies when grown on various surfaces, suggesting condition-dependent regulation of metabolic genes including those involved in energy production .

What structural and functional domains characterize V. paradoxus UbiB, and how do they compare to homologs?

V. paradoxus UbiB likely contains an ABC/ATPase domain characteristic of the protein family, responsible for ATP binding and hydrolysis. The protein is predicted to function as a kinase in the ubiquinone biosynthesis pathway, potentially phosphorylating hydroxylated precursors. Comparative analysis with homologous proteins from other bacterial species would likely reveal conserved regions critical for enzymatic function. To fully characterize these domains, researchers should employ protein crystallography, site-directed mutagenesis, and activity assays to identify catalytic residues and substrate binding sites. The genome sequence of V. paradoxus indicates genes for diverse metabolic functions, suggesting that UbiB may have evolved specialized features to support the organism's adaptable lifestyle .

How does UbiB contribute to V. paradoxus stress responses and environmental adaptation?

UbiB likely plays a significant role in V. paradoxus stress responses through its contribution to ubiquinone biosynthesis, which supports both energy production and antioxidant defense. V. paradoxus has evolved as "a superbly adaptable microorganism that is able to survive in ever-changing environmental conditions" . Under oxidative stress, ubiquinone acts as an electron carrier and membrane antioxidant, suggesting that UbiB becomes particularly important during environmental challenges. Transcriptome analysis reveals that V. paradoxus extensively remodels its gene expression under different growth conditions , and UbiB regulation may be part of this adaptive response. The organism's ability to engage in mutually beneficial interactions with plants and other bacteria may be supported by UbiB's role in maintaining energy homeostasis during these complex ecological relationships.

What is the potential relationship between UbiB function and V. paradoxus biofilm formation?

Biofilm formation in V. paradoxus involves substantial transcriptional changes distinct from planktonic growth . While UbiB is not specifically mentioned in the biofilm transcriptome data, energy metabolism genes often show altered expression during the transition to biofilm growth. V. paradoxus EPS biofilms display "substantial regulatory and structural novelty" , suggesting unique metabolic adaptations in this growth mode. Biofilms form readily under various culture conditions and show structural differences depending on environmental factors such as carbon source and shear stress . UbiB may contribute to biofilm formation through ensuring sufficient energy for extracellular matrix production or supporting redox homeostasis within the biofilm architecture. Investigation using UbiB mutants could reveal its specific contributions to biofilm development and maintenance.

What are the optimal protocols for cloning and expressing recombinant V. paradoxus UbiB?

For optimal cloning and expression of recombinant V. paradoxus UbiB, researchers should consider the following protocol:

  • Gene Amplification: Design primers with appropriate restriction sites (such as BamHI and HindIII, which have been successfully used for V. paradoxus gene cloning ) based on the genome sequence available in GenBank (CP002417) .

  • Expression Vector Selection: For initial trials, use a pET-based expression system with an N-terminal His-tag for purification. Alternative systems include pBAD for arabinose-inducible expression or pGEX for GST-fusion proteins.

  • Host Selection: E. coli BL21(DE3) is recommended for initial expression trials, with alternative strains such as C41(DE3) or Rosetta for potential optimization.

  • Expression Conditions: After transformation, culture cells at 30°C rather than 37°C to improve protein solubility. Induce with 0.5 mM IPTG at mid-log phase (OD600 ~0.6) and continue expression for 4-6 hours. For membrane-associated proteins like UbiB, lower induction temperatures (16-18°C) with extended expression times (overnight) may improve functional yields.

  • Purification Strategy:

    • Cell lysis by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Purification using Ni-NTA affinity chromatography

    • Further purification with size exclusion chromatography

This approach can be optimized based on initial results and specific experimental requirements.

What analytical methods are most effective for characterizing UbiB enzymatic activity?

The following analytical methods are recommended for characterizing UbiB enzymatic activity:

Analytical MethodApplicationAdvantagesLimitations
HPLC-MS/MSQuantification of ubiquinone intermediatesHigh sensitivity and specificityRequires specialized equipment
Radioisotope AssaysMeasurement of phosphorylation activityDirect measurement of kinase functionInvolves radioactive materials
Coupled Enzyme AssaysReal-time monitoring of ATP hydrolysisConvenient continuous monitoringPotential interference from coupling enzymes
EPR SpectroscopyCharacterization of electron transferDetects unpaired electronsComplex data interpretation
Oxygen ConsumptionMeasures respiratory chain functionPhysiologically relevantIndirect measure of UbiB activity

For optimal results, researchers should first confirm protein expression and solubility using SDS-PAGE and western blotting. Kinetic parameters can be determined using substrate concentration gradients and initial velocity measurements. Verification of UbiB's role in ubiquinone biosynthesis can be accomplished through complementation studies in UbiB-deficient bacterial strains, measuring respiratory capacity and ubiquinone content.

How can mutagenesis approaches be used to study UbiB structure-function relationships?

To effectively study UbiB structure-function relationships through mutagenesis, researchers should implement a systematic approach:

  • Site-Directed Mutagenesis:

    • Target conserved residues in the ATP-binding pocket using sequence alignment data

    • Mutate predicted catalytic residues to alanine to assess their contribution to function

    • Create chimeric proteins with UbiB regions from other species to identify species-specific functions

  • Random Mutagenesis:

    • Use error-prone PCR to generate a library of UbiB variants

    • Screen for mutants with altered activity using growth-based assays in UbiB-deficient strains

    • Sequence and characterize mutations that affect function

  • Deletion Analysis:

    • Generate truncated versions of UbiB to identify essential domains

    • Create internal deletions to map functional regions

  • In vivo Validation:

    • Introduce mutated versions of UbiB into V. paradoxus via electroporation as described for other genes

    • Assess the ability of mutants to complement UbiB-deficient strains

    • Evaluate phenotypic changes in growth rate, biofilm formation, and stress resistance

  • Structural Analysis:

    • Express and purify mutant proteins for biophysical characterization

    • Use circular dichroism to assess structural integrity

    • Where possible, obtain crystal structures of wild-type and mutant proteins

This multi-faceted approach will provide insights into critical residues for UbiB function and reveal how protein structure relates to its role in ubiquinone biosynthesis.

How does UbiB function integrate with the metabolic diversity of V. paradoxus?

UbiB function integrates with the remarkable metabolic diversity of V. paradoxus through its essential role in ubiquinone biosynthesis, which supports the organism's aerobic metabolism across diverse ecological niches. V. paradoxus can utilize a wide range of natural compounds and contaminants as growth substrates , requiring flexible energy generation systems. The complete genome sequence of V. paradoxus reveals an impressive array of catabolic pathways , many of which feed electrons into the respiratory chain where ubiquinone functions. UbiB likely plays a pivotal role in maintaining ubiquinone levels needed for efficient electron transport during growth on various carbon sources. V. paradoxus demonstrates different surface motility patterns depending on carbon source , suggesting that energy metabolism, potentially involving UbiB, is fine-tuned according to nutritional conditions. The organism's ability to degrade biogenic compounds, anthropogenic contaminants, and engage in symbiotic interactions with plants and bacteria may all depend on efficient respiratory metabolism supported by UbiB activity.

What role might UbiB play in V. paradoxus plant growth promotion capabilities?

V. paradoxus is recognized for its plant growth promotion activities , and UbiB may contribute to these beneficial interactions in several ways:

  • Energy Support for Metabolic Functions: UbiB's role in ubiquinone biosynthesis ensures efficient energy production needed for producing plant growth-promoting compounds and maintaining cellular functions during root colonization.

  • Stress Resistance: Ubiquinone provides antioxidant protection in bacterial membranes, potentially helping V. paradoxus withstand oxidative stress during plant-microbe interactions. This resilience may contribute to the bacterium's persistence in the rhizosphere.

  • Support for Hydrogen Metabolism: V. paradoxus hydrogen gas oxidation has been implicated in plant growth promotion . As an aerobic respiratory process, this likely depends on functional electron transport chains requiring ubiquinone.

  • Biofilm Formation on Root Surfaces: V. paradoxus forms biofilms under various conditions , which may be important for root colonization. Energy metabolism genes, including UbiB, may be differentially regulated during biofilm formation on plant surfaces.

  • Degradation of Plant Signaling Molecules: V. paradoxus can degrade acyl-homoserine lactone signals , which may help modulate plant-microbe signaling. This degradative capacity likely requires energy support from respiratory metabolism involving ubiquinone.

Further research using UbiB mutants in plant growth experiments could clarify the specific contributions of this protein to the plant growth promotion phenotype.

How can systems biology approaches integrate UbiB function into comprehensive models of V. paradoxus metabolism?

Systems biology approaches can effectively integrate UbiB function into comprehensive metabolic models of V. paradoxus through:

  • Genome-Scale Metabolic Reconstruction:

    • Incorporate UbiB into a genome-scale metabolic model based on the complete genome sequence

    • Define the stoichiometry of reactions involving ubiquinone in electron transport chains

    • Establish network connections between ubiquinone metabolism and diverse catabolic pathways

  • Multi-Omics Data Integration:

    • Integrate transcriptomic data from different growth conditions to understand UbiB regulation

    • Incorporate proteomic analyses to quantify UbiB protein levels under various conditions

    • Use metabolomic approaches to track ubiquinone and related metabolites

  • Flux Balance Analysis:

    • Develop constraint-based models to predict how UbiB activity affects metabolic flux distribution

    • Simulate the effects of UbiB perturbation on growth rates with different carbon sources

    • Model the energetic requirements of biofilm formation versus planktonic growth

  • Predictive Modeling For Environmental Responses:

    • Create models predicting how UbiB function changes during environmental transitions

    • Simulate the effects of oxygen limitation on ubiquinone-dependent metabolism

    • Model the metabolic interactions between V. paradoxus and plant hosts or microbial consortium partners

  • Experimental Validation:

    • Test model predictions using UbiB mutants and different growth conditions

    • Measure respiratory rates, ATP production, and growth yields to validate model outputs

    • Refine models iteratively based on experimental results

This integrated systems approach would provide a comprehensive understanding of how UbiB contributes to the metabolic flexibility that makes V. paradoxus "a superbly adaptable microorganism" capable of thriving in diverse ecological contexts.

What emerging technologies could advance our understanding of UbiB function in V. paradoxus?

Several emerging technologies hold promise for advancing our understanding of UbiB function in V. paradoxus:

  • CRISPR-Cas9 Genome Editing:

    • Develop efficient CRISPR systems for V. paradoxus to create precise UbiB mutations

    • Generate conditional knockdowns to study essential functions

    • Create reporter fusions to monitor UbiB expression in real-time

  • Single-Cell Techniques:

    • Apply single-cell RNA-seq to understand UbiB expression heterogeneity in biofilms

    • Use fluorescent reporters to track UbiB expression at the single-cell level

    • Employ microfluidics to analyze individual cell responses to environmental changes

  • Advanced Structural Biology:

    • Utilize cryo-electron microscopy to determine UbiB structure in membrane context

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Use AlphaFold or similar AI-based prediction methods to model protein interactions

  • In situ Techniques:

    • Develop RNA-FISH methods to visualize UbiB transcript localization

    • Apply correlative light and electron microscopy to study UbiB in cellular context

    • Use proximity labeling to identify interaction partners in vivo

  • Metabolic Flux Analysis:

    • Employ 13C labeling and metabolic flux analysis to track carbon flow through pathways dependent on ubiquinone

    • Use non-invasive NMR to monitor metabolic changes in real-time

These technologies could be particularly valuable for understanding UbiB's role in the context of V. paradoxus' complex transcriptional responses to different growth conditions and its remarkable metabolic diversity .

How might comparative genomics of UbiB across Variovorax species inform evolutionary adaptations?

Comparative genomics of UbiB across Variovorax species can provide valuable insights into evolutionary adaptations through:

  • Sequence Conservation Analysis:

    • Identify highly conserved regions indicating essential functional domains

    • Detect variable regions potentially associated with species-specific adaptations

    • Calculate selection pressures (dN/dS ratios) to identify sites under positive selection

  • Genomic Context Comparison:

    • Analyze the organization of ubiquinone biosynthesis gene clusters across species

    • Identify differences in regulatory elements that may affect expression patterns

    • Detect horizontal gene transfer events that might have influenced UbiB evolution

  • Phylogenetic Analysis:

    • Construct phylogenetic trees based on UbiB sequences to understand evolutionary relationships

    • Compare UbiB phylogeny with species phylogeny to detect potential gene duplication events

    • Identify ancestral states and evolutionary innovations

  • Structure-Function Correlations:

    • Map sequence variations onto predicted protein structures

    • Identify structural adaptations potentially related to substrate specificity or efficiency

    • Correlate structural features with ecological niches of different Variovorax species

  • Ecological Correlation:

    • Associate UbiB sequence variations with ecological adaptations of different Variovorax species

    • Correlate UbiB features with metabolic capabilities across the genus

    • Identify potential adaptations related to specific plant-microbe interactions

This approach would complement existing genomic analyses of V. paradoxus and provide a deeper understanding of how UbiB has evolved to support the metabolic versatility that characterizes this bacterial genus.

What potential biotechnological applications could arise from understanding V. paradoxus UbiB?

Understanding V. paradoxus UbiB could lead to several innovative biotechnological applications:

  • Engineered Bioremediation Systems:

    • Optimize UbiB expression to enhance V. paradoxus degradation of xenobiotics

    • Create engineered strains with improved energy efficiency for environmental cleanup

    • Develop biosensors based on UbiB regulation to detect bioavailable pollutants

  • Agricultural Bioinoculants:

    • Engineer V. paradoxus strains with optimized UbiB function for improved plant growth promotion

    • Develop stress-resistant strains for harsh agricultural environments

    • Create co-cultures with optimized metabolic interactions for sustainable agriculture

  • Ubiquinone Production:

    • Develop cell factories with engineered UbiB for enhanced ubiquinone production

    • Create pathway-optimized strains for production of ubiquinone variants with pharmaceutical applications

    • Design synthetic biology circuits to regulate ubiquinone biosynthesis

  • Protein Engineering:

    • Use UbiB structure-function insights to create novel kinases with desired properties

    • Engineer UbiB for improved stability or altered substrate specificity

    • Develop UbiB-based biosensors for ATP or related molecules

  • Biofilm Engineering:

    • Manipulate UbiB expression to control biofilm formation for beneficial applications

    • Develop energy-efficient biofilms for biocatalysis or bioremediation

    • Create specialized biofilms with enhanced resistance to environmental stressors

These applications align with the recognized potential of V. paradoxus for biotechnological applications , leveraging its metabolic versatility and adaptability to create innovative solutions for environmental and agricultural challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.