Recombinant Variovorax paradoxus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Mechanism

uppP catalyzes the hydrolysis of UPP to UP, a reaction essential for maintaining the cellular pool of UP. UP is required for transporting glycan precursors across the cytoplasmic membrane, enabling the assembly of peptidoglycan, lipopolysaccharides, and other extracellular polymers . Key aspects include:

  • UP Recycling: After UPP is generated during glycan polymerization, uppP removes the terminal phosphate group, regenerating UP for reuse. This cycle prevents UP depletion, which would halt cell wall synthesis and trigger cell lysis .

  • Antibiotic Resistance: UPP phosphatases like uppP are implicated in resistance to bacitracin, which binds UPP and inhibits its dephosphorylation. Mutations in uppP or related genes (e.g., bcrC) reduce bacitracin resistance by limiting UP recycling .

  • Stress Response: In Bacillus subtilis, UPP phosphatases are regulated by the σᴹ stress-response system, which prioritizes UP allocation to peptidoglycan synthesis during envelope stress .

Key Research Insights

  • Enzymatic Activity: uppP demonstrates specificity for UPP over other phospholipids, aligning with its role in UP recycling .

  • Co-Expression with Metabolic Genes: In Variovorax paradoxus, uppP may be co-transcribed with genes involved in amino acid metabolism (e.g., N-d-amino acid amidohydrolase), suggesting functional integration in cellular stress responses .

  • Synthetic Lethality: In B. subtilis, deletion of both uppP and bcrC is synthetic lethal, underscoring the essentiality of UPP phosphatases in maintaining UP homeostasis .

Applications in Research and Biotechnology

  • Antibiotic Development: Studies on uppP homologs inform strategies to disrupt UP recycling, enhancing antibiotic efficacy (e.g., bacitracin) .

  • Cell Wall Studies: Recombinant uppP is used to investigate UPP phosphatase activity in vitro, aiding mechanistic studies of peptidoglycan and lipopolysaccharide biosynthesis .

  • Protein Engineering: Structural models of uppP guide site-directed mutagenesis to probe catalytic residues and optimize enzyme function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Vapar_3599; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Variovorax paradoxus (strain S110)
Target Names
uppP
Target Protein Sequence
MDIVLLVKAAVMGIVEGLTEFLPISSTGHLILAGSLLGFDDDKAKVFDIAIQTGAIFAVI LVYWQKIHSTVVALPRQAKARRLALNVVIGFLPAVVLGLLFGKMIKAHLFIPVVVASTFI IGGFIILWAEKRPPGSVRIEHVDDMTMWDALKVGLVQCFAMIPGTSRSGSTIIGGMLLGL SRQAATDFSFFLAIPTLIGAGAYSLYKERALLSVADIPLFSVGLVFSFISAWLCVRWLLK YISTHDFIPFAWYRIAFGIVVLATAWTGTVVWAE
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Variovorax paradoxus Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial physiology?

Undecaprenyl-diphosphatase (uppP) from Variovorax paradoxus is a critical enzyme involved in bacterial cell wall biosynthesis. It is officially classified as EC 3.6.1.27 and also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase . The enzyme functions by hydrolyzing the pyrophosphate bond in undecaprenyl diphosphate, releasing phosphate and generating undecaprenyl phosphate, which is essential for peptidoglycan biosynthesis pathways. This activity is crucial for bacterial cell growth and survival, as the undecaprenyl diphosphate product (UPP) is required for cell wall formation . The enzyme represents an important component in the lipid carrier cycle that facilitates the transport of peptidoglycan precursors across the cytoplasmic membrane during cell wall assembly.

The significance of uppP extends beyond basic cellular functions, as it also contributes to antibiotic resistance. The "Bacitracin resistance protein" alternative name indicates its role in protecting bacteria against this specific class of antibiotics, which target cell wall synthesis pathways.

How does uppP fit into bacterial cell wall biosynthesis pathways?

Undecaprenyl-diphosphatase (uppP) occupies a critical position in the bacterial cell wall biosynthesis pathway. The enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to produce undecaprenyl phosphate (UP), which serves as a lipid carrier for peptidoglycan precursors . This lipid-linked cycle is essential for the translocation of cell wall building blocks across the cytoplasmic membrane.

The significance of this process becomes evident when examining bacterial cell wall formation mechanisms:

  • UPP is produced by undecaprenyl diphosphate synthase (UPPS)

  • UPP is then dephosphorylated by uppP to form UP

  • UP serves as a carrier lipid that accepts peptidoglycan precursors in the cytoplasm

  • The resulting complex is flipped across the membrane

  • The peptidoglycan unit is incorporated into the growing cell wall

  • UPP is released and recycled by uppP to continue the cycle

This pathway is critical for bacterial survival, which explains why enzymes like uppP are attractive targets for antibiotic development. Inhibitors that target uppP or related enzymes can effectively disrupt cell wall biosynthesis, leading to bacterial cell death .

What experimental approaches are most effective for analyzing recombinant V. paradoxus uppP activity?

Several complementary approaches can be employed to effectively analyze recombinant V. paradoxus uppP activity:

  • Spectrophotometric Continuous Assays: Similar to methods used for UPPS, continuous spectrophotometric assays can be adapted for uppP activity measurements. For example, coupling the release of inorganic phosphate to a chromogenic reaction using reagents like 2-amino-6-mercapto-7-methylpurine ribonucleoside (MESG) allows real-time monitoring of enzyme activity . This approach enables researchers to establish reaction kinetics and determine parameters such as Km and Vmax.

  • Radiometric Assays: For higher sensitivity and specificity, radiometric assays employing radiolabeled substrates (such as [³H]-labeled undecaprenyl diphosphate) can be utilized . These assays provide direct quantification of substrate conversion and are particularly valuable for inhibitor screening and mechanistic studies.

  • Nanoparticle-Based Approaches: Recent research with other enzymes from V. paradoxus has demonstrated that enzymatic nanoparticles can exhibit enhanced catalytic efficiency compared to native enzymes . A similar approach may be applicable to uppP, where enzyme nanoparticles could be prepared using desolvation-crosslinking methods to potentially improve stability and activity.

For optimal results, activity assays should incorporate appropriate detergents (e.g., 0.01% v/v Triton X-100) to maintain enzyme solubility and accessibility to the lipid substrate . Additionally, careful buffer optimization is critical, with Tris-based buffers at pH 7.5 serving as a reasonable starting point based on related enzymes .

How can researchers address solubility and stability challenges when working with recombinant uppP?

Membrane-associated enzymes like uppP present significant challenges regarding solubility and stability. Here are methodological approaches to address these issues:

  • Optimized Expression Systems:

    • Use bacterial expression hosts adapted for membrane proteins

    • Consider fusion tags that enhance solubility (MBP, SUMO, or thioredoxin)

    • Test expression at lower temperatures (16-20°C) to improve folding

  • Solubilization Strategies:

    • Include appropriate detergents in purification buffers (e.g., Triton X-100, DDM, or CHAPS)

    • Test mixed micelle systems with lipids that mimic native membrane environment

    • Consider nanodiscs or liposome reconstitution for activity studies

  • Storage Optimization:

    • Maintain in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots for storage at 4°C for short-term use

  • Nanoparticle Formation:

    • Consider adapting the desolvation-crosslinking method used for other V. paradoxus enzymes

    • Enzyme nanoparticles have demonstrated enhanced thermostability and longer serum half-life compared to native enzymes

    • This approach could potentially address both solubility and stability challenges simultaneously

  • Activity Preservation:

    • Include stabilizing cofactors in storage buffer (e.g., Mg²⁺)

    • Consider the addition of reducing agents if cysteine residues are present

    • Validate enzyme activity periodically during storage

A systematic approach involving careful optimization of each of these parameters will help maintain uppP in an active, stable state throughout experimental procedures.

What are the key considerations for designing inhibitor screening assays for uppP?

Designing effective inhibitor screening assays for uppP requires careful consideration of multiple factors:

  • Assay Selection and Validation:

    • Primary screening can utilize spectrophotometric methods based on phosphate release detection

    • Confirmatory assays should employ radiometric approaches for higher specificity

    • Validate assays with known inhibitors or substrate analogs before large-scale screening

  • Screening Parameters Optimization:

    • Determine optimal enzyme concentration that provides robust signal-to-noise ratio

    • Establish substrate concentration at or slightly below Km to identify competitive inhibitors

    • Include appropriate controls (vehicle, positive inhibition, enzyme activity)

    • Optimize detergent concentration to maintain enzyme activity without interfering with inhibitor binding

  • Data Analysis Approach:

    • Calculate IC₅₀ values using dose-response curves fitted to rectangular hyperbolic functions

    • Compare inhibition patterns across different substrate concentrations to determine inhibition mechanism

    • Establish threshold criteria for hit identification and prioritization

  • Counter-screening Strategy:

    • Test hits against related enzymes to assess specificity

    • Evaluate inhibition of enzymatic activity in bacterial membrane preparations

    • Screen for potential cytotoxicity against mammalian cells to establish therapeutic index

  • Structure-Activity Relationship (SAR) Analysis:

    • Classify inhibitors based on chemical scaffolds

    • Analyze binding modes using computational docking when structural data is available

    • Design focused libraries based on initial hits for optimization

Recent approaches with related enzymes like UPPS have demonstrated the value of virtual screening validated against multiple crystal structures to identify novel inhibitor scaffolds . Similar computational approaches could be adapted for uppP inhibitor discovery, potentially leveraging binding site information from homologous enzymes.

How does V. paradoxus uppP compare with homologous enzymes from other bacterial species?

Undecaprenyl-diphosphatase (uppP) belongs to a family of phosphatases that are widely distributed across bacterial species, reflecting their essential role in cell wall biosynthesis. Comparative analysis reveals several key points:

This comparative perspective is valuable for researchers seeking to understand the broader biological context of uppP function and for those developing targeted antimicrobial strategies.

What ecological and evolutionary insights can be gained from studying V. paradoxus uppP?

Studying V. paradoxus uppP can provide valuable insights into bacterial adaptation and evolution:

  • Metabolic Versatility Context:
    V. paradoxus is known for its remarkable metabolic versatility and ability to thrive in diverse ecological niches . The uppP enzyme functions within this broader context of metabolic adaptability, potentially contributing to the bacterium's ability to colonize different environments. The specific properties of uppP may reflect adaptations to particular ecological pressures faced by V. paradoxus.

  • Horizontal Gene Transfer Considerations:
    Comparative genomic analysis could reveal whether uppP in V. paradoxus shows evidence of horizontal gene transfer or whether it has evolved primarily through vertical inheritance. Such analysis might be performed using the complete genome sequence data available for V. paradoxus .

  • Selection Pressures from Antibiotics:
    Given that uppP contributes to bacitracin resistance , its evolutionary history may reflect selection pressures from natural antibiotics present in the soil environments where V. paradoxus typically resides. Sequence variations in uppP across different V. paradoxus strains might correlate with exposure to different antibiotic-producing microorganisms.

  • Functional Diversification:
    V. paradoxus has been shown to produce other enzymes with specialized functions, such as the methotrexate-degrading enzyme that has been studied in both native and nanoform . The evolution of uppP could be examined in the context of this broader pattern of enzyme diversification within the species.

  • Plant-Microbe Interaction Relevance:
    Some V. paradoxus strains promote plant growth through mechanisms involving enzymes like ACC deaminase . Investigating whether and how uppP contributes to plant-microbe interactions could provide insights into the evolution of mutualistic relationships between bacteria and plants.

Understanding these ecological and evolutionary aspects of uppP can inform both fundamental research questions and applied efforts to develop new antimicrobial strategies or biotechnological applications.

How can recombinant V. paradoxus uppP be utilized in antibiotic development research?

Recombinant V. paradoxus uppP offers several valuable applications in antibiotic development research:

  • Target-Based Screening Platform:

    • The purified recombinant enzyme provides a defined system for high-throughput screening of potential inhibitors

    • Both in vitro enzyme activity assays and in silico screening approaches can be employed

    • Structure-activity relationship studies can be conducted to optimize lead compounds

  • Resistance Mechanism Studies:

    • As uppP confers resistance to bacitracin , it serves as a model for studying antibiotic resistance mechanisms

    • Investigations of uppP variants can illuminate pathways to resistance development

    • Combination therapy approaches targeting both uppP and other cell wall synthesis enzymes can be explored

  • Comparative Inhibition Profiling:

    • Testing inhibitors against uppP from different bacterial species can identify broad-spectrum versus selective agents

    • The approach used with UPPS inhibitors, where virtual screening was validated against multiple crystal structures, could be adapted for uppP

    • Inhibition profiles can help predict antimicrobial spectrum of new compounds

  • Novel Binding Site Identification:

    • Studies of the related enzyme UPPS have revealed multiple inhibitor binding sites (sites 1, 3, and 4)

    • Similar analysis of uppP could identify unique binding pockets for selective inhibition

    • Allosteric inhibitors targeting non-catalytic sites might provide new avenues for antibiotic development

The emergence of antibiotic resistance has created an urgent need for new antimicrobial agents with novel mechanisms of action. As an essential enzyme in bacterial cell wall biosynthesis that is absent in mammalian cells, uppP represents an attractive target for developing new antibiotics with potentially limited side effects.

What methodological approaches are recommended for engineering improved variants of uppP?

Engineering improved variants of uppP for research or biotechnological applications can be approached through several methodological strategies:

  • Rational Design Based on Sequence Analysis:

    • Identify conserved catalytic residues through multiple sequence alignment of uppP homologs

    • Target non-conserved residues near the active site to modify substrate specificity

    • Introduce stability-enhancing mutations based on consensus sequence analysis

  • Site-Directed Mutagenesis:

    • Create alanine scanning libraries to identify functionally critical residues

    • Introduce specific mutations to alter catalytic properties (Km, kcat, substrate preference)

    • Modify surface residues to enhance solubility while maintaining membrane association

  • Directed Evolution:

    • Develop a high-throughput screening system for uppP activity

    • Apply error-prone PCR to generate variant libraries

    • Use selective pressure (e.g., growth in the presence of bacitracin) to identify improved variants

  • Domain Swapping/Chimeric Enzymes:

    • Create chimeric constructs combining domains from uppP homologs with desired properties

    • Exchange membrane-spanning regions to optimize expression in different systems

    • Incorporate domains from related phosphatases to introduce novel functionalities

  • Nanoparticle Formulation:

    • Adapt the desolvation-crosslinking method demonstrated with other V. paradoxus enzymes

    • Optimize crosslinking conditions to enhance stability while preserving activity

    • Characterize the kinetic parameters (Km, thermostability) of nanoparticle forms compared to the native enzyme

Each approach has distinct advantages, and a comprehensive engineering strategy might employ multiple methods in parallel or sequence. The successful application of nanoparticle technology to other V. paradoxus enzymes, resulting in enhanced stability and activity , suggests this approach may be particularly promising for uppP.

What future research directions might advance understanding of uppP structure-function relationships?

Several research directions could significantly advance our understanding of uppP structure-function relationships:

  • Structural Characterization:

    • Pursue X-ray crystallography of uppP, potentially using fusion partners or antibody fragments to facilitate crystallization

    • Apply cryo-electron microscopy to visualize uppP in membrane environments

    • Utilize hydrogen-deuterium exchange mass spectrometry to map dynamic regions and substrate interactions

  • Computational Modeling:

    • Develop refined homology models based on related phosphatases with known structures

    • Perform molecular dynamics simulations to understand membrane integration and substrate access

    • Apply quantum mechanics/molecular mechanics approaches to elucidate the catalytic mechanism

  • Substrate Specificity Studies:

    • Systematically investigate uppP activity with substrate analogs varying in chain length and structure

    • Characterize kinetic parameters for natural and synthetic substrates

    • Identify structural determinants of specificity through targeted mutagenesis

  • Integration with Systems Biology:

    • Investigate the regulatory network controlling uppP expression in V. paradoxus

    • Examine the metabolic impact of uppP modulation using metabolomics

    • Study the role of uppP in broader cellular processes beyond cell wall synthesis

  • Translational Research:

    • Explore biotechnological applications of uppP, potentially in biocatalysis

    • Investigate whether uppP contributes to the plant growth-promoting effects observed with V. paradoxus

    • Develop uppP-based biosensors for detecting cell wall-targeting antibiotics

These research directions, pursued in parallel, would provide a comprehensive understanding of uppP function at molecular, cellular, and systems levels, potentially leading to new applications in antimicrobial development and biotechnology.

What quality control measures should be implemented when working with recombinant V. paradoxus uppP?

Implementing rigorous quality control measures is essential when working with recombinant V. paradoxus uppP to ensure experimental reproducibility and reliable results:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie staining to verify >90% purity

    • Western blot confirmation using tag-specific or uppP-specific antibodies

    • Mass spectrometry to confirm protein identity and detect potential modifications

  • Activity Verification:

    • Establish standard enzymatic assay conditions with defined specific activity metrics

    • Perform kinetic characterization to obtain baseline Km and Vmax values

    • Conduct inhibition assays with known inhibitors as positive controls

  • Stability Monitoring:

    • Track activity retention during storage using regular activity assays

    • Assess thermal stability using differential scanning fluorimetry

    • Monitor oligomerization state by size exclusion chromatography

  • Batch Consistency:

    • Maintain detailed records of expression conditions, purification methods, and yields

    • Establish acceptance criteria for specific activity between batches

    • Prepare reference standards for comparative analysis

  • Functional Validation:

    • Verify expected biological activity in relevant assay systems

    • Confirm substrate specificity with multiple substrate analogs

    • Test sensitivity to expected inhibitors and environmental conditions

A standardized protocol incorporating these quality control measures should be established and applied consistently across all experimental work with recombinant uppP, ensuring that observed effects can be attributed to the experimental variables rather than inconsistencies in enzyme preparation.

What are the optimal conditions for expressing and purifying recombinant V. paradoxus uppP?

Based on available information and experience with similar membrane-associated enzymes, the following methodological approach is recommended for optimal expression and purification of recombinant V. paradoxus uppP:

  • Expression System Selection:

    • For basic research: E. coli BL21(DE3) with T7 promoter-based expression vectors

    • For structural studies: C41(DE3) or C43(DE3) strains specifically designed for membrane proteins

    • Consider codon-optimization of the uppP gene sequence for the chosen expression host

  • Expression Conditions:

    • Induce expression at lower temperatures (16-20°C) to promote proper folding

    • Use moderate inducer concentrations to prevent formation of inclusion bodies

    • Extend expression time to 16-20 hours under gentle agitation

    • Supplement media with appropriate cofactors (e.g., Mg²⁺)

  • Purification Strategy:

    • Membrane isolation through differential centrifugation

    • Solubilization using mild detergents (e.g., DDM, CHAPS, or Triton X-100)

    • Affinity chromatography utilizing a fusion tag (His-tag or Strep-tag)

    • Size exclusion chromatography for final polishing and buffer exchange

  • Buffer Optimization:

    • Maintain Tris-based buffer systems at pH 7.5

    • Include glycerol (10-50%) to enhance stability

    • Add appropriate detergent at concentrations above CMC but below levels that might interfere with activity

    • Consider adding stabilizing agents such as trehalose or specific lipids

  • Storage Conditions:

    • Store at -20°C or -80°C in buffer containing 50% glycerol

    • Prepare working aliquots to avoid repeated freeze-thaw cycles

    • For extended experiments, maintain working aliquots at 4°C for up to one week

This methodological approach should yield recombinant uppP with high purity and preserved enzymatic activity suitable for various research applications.

What are the broader implications of V. paradoxus uppP research for antimicrobial development?

Research on V. paradoxus uppP has significant implications for antimicrobial development strategies:

  • Novel Target Validation:

    • uppP represents part of a class of essential bacterial enzymes that have been underexplored as antibiotic targets

    • The critical role of uppP in cell wall biosynthesis makes it an attractive target for developing new antibiotics

    • Research on V. paradoxus uppP contributes to validating this enzyme family as a viable intervention point

  • Resistance Mechanism Insights:

    • Understanding the structural and functional aspects of uppP that confer bacitracin resistance can inform strategies to overcome or circumvent resistance

    • Comparative studies across bacterial species may reveal conserved features that could be targeted to minimize resistance development

    • Combination approaches targeting both uppP and other cell wall synthesis enzymes might provide synergistic effects and reduce resistance emergence

  • Screening Platform Development:

    • Well-characterized recombinant uppP provides a platform for high-throughput screening of potential inhibitors

    • The approaches used for UPPS inhibitor discovery, combining crystallographic analysis with virtual screening , could be adapted for uppP

    • Availability of purified enzyme enables both biochemical and biophysical screening methods

  • Structure-Based Drug Design:

    • Detailed structural information about uppP would facilitate rational design of inhibitors

    • Identification of allosteric binding sites, similar to the multiple sites found in UPPS , could lead to novel inhibition strategies

    • Fragment-based approaches could be particularly valuable given the membrane-associated nature of the target

The continuing evolution of antibiotic resistance presents an urgent need for new antimicrobial agents with novel mechanisms of action. Research on bacterial phosphatases like uppP contributes to addressing this global health challenge by expanding the repertoire of validated targets and approaches for antibiotic development.

How might V. paradoxus uppP research contribute to understanding bacterial adaptation and survival mechanisms?

Research on V. paradoxus uppP provides valuable insights into bacterial adaptation and survival mechanisms:

  • Membrane Homeostasis Understanding:

    • uppP functions at the interface of cell wall synthesis and membrane biology

    • Research on this enzyme illuminates how bacteria maintain membrane integrity under various environmental conditions

    • The regulatory control of uppP may reveal mechanisms by which bacteria adapt membrane composition in response to stress

  • Ecological Adaptation Mechanisms:

    • V. paradoxus is known for its metabolic versatility and ability to thrive in diverse ecological niches

    • Understanding how uppP contributes to this versatility may reveal broader principles of bacterial adaptation

    • Comparative analysis of uppP across V. paradoxus strains from different environments could highlight adaptive variations

  • Antibiotic Resistance Evolution:

    • The dual role of uppP in essential cell functions and antibiotic resistance makes it an interesting model for studying the evolution of resistance mechanisms

    • Research may reveal whether resistance is an incidental consequence of the enzyme's primary function or a specifically selected trait

    • The molecular basis of bacitracin resistance through uppP activity provides insights into evolutionary trade-offs between resistance and fitness

  • Interspecies Interactions:

    • Some V. paradoxus strains have been shown to participate in beneficial interactions with plants

    • Investigating whether and how cell wall modifications influenced by uppP contribute to these interactions could illuminate bacterial strategies for establishing symbiotic relationships

    • The potential role of uppP in competitive interactions with other soil microorganisms merits exploration

  • Stress Response Integration:

    • Cell envelope stress responses are critical for bacterial survival

    • Research on how uppP activity is regulated during stress could reveal integration mechanisms between metabolic pathways and stress response systems

    • The connection between cell wall integrity maintenance and other adaptation mechanisms may be clarified through uppP studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.