Recombinant Vaucheria litorea ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Vaucheria litorea ATP synthase subunit b, chloroplastic (atpF) is a component of the ATP synthase enzyme found in the chloroplasts of the alga Vaucheria litorea . ATP synthase, also known as F1F0-ATPase, is a multimeric enzyme complex that produces adenosine triphosphate (ATP) using a proton or sodium gradient . ATP is the primary energy currency in cells, essential for various metabolic processes, including photosynthesis in chloroplasts . The ATP synthase complex comprises two main domains: F1, the catalytic core, and F0, the membrane proton channel. These domains are connected by a central and a peripheral stalk.

Structure and Function

The atpF subunit is a component of the F0 domain, specifically part of the peripheral stalk that links F1 to F0. The F0 domain is embedded in the thylakoid membrane and contains a ring of c-subunits through which protons are translocated, driving the rotation of the ring . The number of c-subunits in the ring varies depending on the organism, influencing the ratio of protons translocated to ATP synthesized .
During ATP synthesis, the proton gradient across the thylakoid membrane drives the rotation of the c-subunit ring . This mechanical rotation is coupled to ATP synthesis in the F1 domain.

Vaucheria litorea and Chloroplast Symbiosis

Vaucheria litorea is a yellow-green alga known for its symbiotic relationship with the sea slug Elysia chlorotica . The sea slug ingests the algae and incorporates its chloroplasts into its own cells, allowing it to perform photosynthesis . The chloroplasts remain functional within the sea slug for an extended period, providing the slug with energy .

Recombinant Production and Purification

Recombinant production of the atpF subunit involves expressing the gene in a host organism, such as E. coli, and then purifying the protein for research purposes . One method involves expressing the atpF subunit as a fusion protein with maltose-binding protein (MBP) to enhance solubility . The MBP tag is then cleaved off, and the atpF subunit is purified using techniques like reversed-phase chromatography .

Research Findings

The study of ATP synthase subunits, including atpF, helps elucidate the enzyme's structure, function, and regulation. Research has focused on the effects of mutations and modifications, such as phosphorylation, on ATP synthase activity .

  • Phosphorylation Studies: Phosphorylation of the ATP synthase β subunit can affect the enzyme's activity and assembly. For example, mimicking phosphorylation at specific residues can block ATPase function or affect dimer formation .

  • Redox Regulation: The chloroplast ATP synthase is also regulated by redox modulation of a disulfide/sulfhydryl pair on the γ subunit via thioredoxin. This redox regulation modulates the proton motive force (pmf) required to activate the ATP synthase and prevent wasteful ATP hydrolysis in the dark .

  • Expression Studies: Studies have shown that chloroplast genes, including those encoding ATP synthase subunits, are actively transcribed and translated within the symbiotic chloroplasts in Elysia chlorotica .

Tables and Data

PropertyDescription
Target NameatpF
SynonymsATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
SourceVaucheria litorea (Yellow-green alga)
Uniprot No.B7T1R8
FunctionComponent of the F(0) channel, forming part of the peripheral stalk that connects F(1) to F(0). F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation.
Purity>85% (SDS-PAGE)
Storage ConditionStore at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Buffer Before LyophilizationTris/PBS-based buffer, 6% Trehalose

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Vaucheria litorea (Yellow-green alga)
Target Names
atpF
Target Protein Sequence
MKNWISSFILVHQEKSISFNTNILETNLINIIILLIILFYFLKGLLKDNLSSRQENILST IQNSENRINEANERLVDAKLQWSQAQITLEELKNQTLQNKLILFNAEFEIKNQVLSQHFN NLLMTLYYREQQAFNNIKKQVSELALKKVIAKLQAPLMEEDQSVIIINKIHRLGGNLE
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Vaucheria litorea ATP synthase subunit b, and what is its role in chloroplast function?

Vaucheria litorea ATP synthase subunit b (atpF) is a peripheral stalk component of the chloroplast ATP synthase complex. This protein plays a critical role in maintaining the structural integrity of the ATP synthase by connecting the F₁ catalytic domain to the membrane-embedded F₀ domain. The peripheral stalk prevents rotation of the α₃β₃ hexamer during ATP synthesis, enabling efficient energy conversion.

The full-length protein consists of 178 amino acids and functions as part of the energy conservation machinery in chloroplasts, contributing to the proton gradient-driven synthesis of ATP during photosynthesis .

How does Vaucheria litorea atpF compare to homologs in other photosynthetic organisms?

Vaucheria litorea atpF shares structural and functional similarities with homologs in other photosynthetic organisms, but with species-specific adaptations. When compared with the chloroplast ATP synthase in Chlamydomonas reinhardtii, both contain peripheral stalk subunits that are essential for ATP synthase biogenesis and functional assembly.

Research on C. reinhardtii has shown that mutations affecting the peripheral stalk subunits b and b' (encoded by atpF and ATPG respectively) can completely prevent ATP synthase accumulation and function, highlighting their critical importance across species .

Unlike some other Stramenopiles where the motif ASAFAP is frequently found at the border of the ctER signal sequence and plastid transit peptide, V. litorea contains an altered motif SFV. Site-directed mutagenesis studies have shown that the Phe residue in these motifs is relatively important for protein transport into diatom plastids .

What expression systems are optimal for producing recombinant Vaucheria litorea atpF protein?

The optimal expression system for recombinant Vaucheria litorea atpF is E. coli. Commercial preparations typically use E. coli expression systems with an N-terminal His-tag for ease of purification. This approach allows for high-yield production of the full-length protein (amino acids 1-178).

The methodology involves:

  • Cloning the atpF gene into an appropriate expression vector

  • Transformation into an E. coli expression strain

  • Induction of protein expression (typically using IPTG)

  • Cell lysis and extraction

  • Affinity purification using the His-tag

  • Quality control assessment by SDS-PAGE (>90% purity)

What are the recommended storage and handling conditions for recombinant Vaucheria litorea atpF?

For optimal stability and activity of recombinant Vaucheria litorea atpF, the following storage and handling conditions are recommended:

ParameterRecommendation
Storage temperature-20°C to -80°C for long-term
Working storage4°C for up to one week
FormLyophilized powder (for shipping/storage)
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
AliquotingAdd 5-50% glycerol (final concentration) and aliquot
Freeze-thawMinimize repeated freeze-thaw cycles

Before opening, it is advised to briefly centrifuge the vial to bring contents to the bottom. Repeated freezing and thawing should be avoided to prevent protein degradation and loss of activity .

How can researchers verify the integrity and functionality of recombinant atpF protein preparations?

To verify the integrity and functionality of recombinant Vaucheria litorea atpF preparations, researchers should employ multiple complementary approaches:

  • Structural integrity assessment:

    • SDS-PAGE analysis to confirm correct molecular weight (>90% purity)

    • Western blotting with anti-His antibodies to verify tag presence

    • Circular dichroism spectroscopy to assess secondary structure

  • Functional assessment:

    • ATP binding assays using fluorescent ATP analogs such as TNP-ATP

    • Interactions with other ATP synthase subunits using pull-down assays

    • Assembly assays with other ATP synthase components

  • Advanced validation:

    • Mass spectrometry for precise molecular weight determination

    • Testing interactions with NADH, which can be measured by fluorescence methods at 440 nm emission peak

    • Stoichiometry determination using the intersection point of lines fit by linear regression to the low-occupancy and plateau regions of the titration data

What methods are most effective for studying atpF interactions with other ATP synthase subunits?

To effectively study atpF interactions with other ATP synthase subunits, researchers should consider multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against atpF or its tag to pull down interacting proteins

    • Identify binding partners using mass spectrometry

    • Verify interactions with western blotting using subunit-specific antibodies

  • Fluorescence-based interaction assays:

    • TNP-ATP binding can be evaluated by fluorescence measurements at 545 nm

    • NADH binding can be measured at 440 nm emission

    • Binding stoichiometry can be determined from the intersection point of lines fit by linear regression to the low-occupancy and plateau regions of the titration data

  • Crosslinking studies:

    • Chemical crosslinking combined with mass spectrometry to identify proximity relationships

    • Photo-crosslinking with site-specific incorporation of photo-activatable amino acids

  • Mutational analysis:

    • Create point mutations or deletions in conserved regions

    • Assess the impact on complex assembly and function

    • Compare to studies on related organisms like Chlamydomonas reinhardtii, where knock-out mutations of ATP synthase components completely prevent complex accumulation

What structural features of atpF are critical for its function in ATP synthase?

Several structural features of atpF are critical for its function in ATP synthase:

  • Transmembrane domain: The N-terminal region contains hydrophobic sequences that anchor the protein in the thylakoid membrane.

  • Coiled-coil domains: These regions facilitate interactions with other peripheral stalk components and with the F₁ sector, maintaining the proper architecture of the complex.

  • Conserved residues: Specific amino acid sequences are conserved across species and are essential for proper folding, assembly, and function.

  • Folding motifs: The protein contains structural elements that contribute to its stability and ability to interact correctly with other ATP synthase components.

Comparing these features with other organisms, we see in V. litorea an altered motif SFV where the ASAFAP motif is typically found at the border of the ctER signal sequence and plastid transit peptide in Stramenopiles. Site-directed mutagenesis has shown that the Phe residue in these motifs is important for protein transport into plastids .

How can researchers use in vitro systems to study atpF mRNA processing and splicing?

Researchers can develop and utilize in vitro systems to study atpF mRNA processing and splicing using the following methodology:

  • Preparation of atpF gene fragment:

    • Design primers containing the T7 promoter and part of the atpF 5' exon (forward) and part of the atpF 3' exon with a restriction site (reverse)

    • Perform two successive PCR amplifications of the chloroplast DNA

    • Clone the fragment into an appropriate vector (e.g., pIVS vector)

    • Linearize the plasmid and transcribe using T7 RNA polymerase to generate pre-mRNA substrates

  • In vitro splicing reaction:

    • Prepare chloroplast extracts from appropriate tissue

    • Set up splicing reactions with pre-mRNA substrates and chloroplast extracts

    • Incubate under optimized conditions (typically 2 hours)

    • Analyze splicing products using gel electrophoresis

  • Detection and quantification:

    • Use reverse transcription PCR (RT-PCR) to detect spliced products

    • Verify the size of spliced mRNA (approximately 340 nt for atpF)

    • Include controls lacking chloroplast extract or pre-mRNA to validate specificity

  • Mutational analysis:

    • Introduce mutations in domain V (DV), which comprises the main active site for splicing

    • Assess the impact on splicing efficiency

What approaches can be used to study the role of atpF in bioenergetics and photosynthesis?

To investigate the role of atpF in bioenergetics and photosynthesis, researchers can employ several sophisticated approaches:

  • Genetic manipulation:

    • CRISPR-Cas9 gene editing to create knockout or knockdown mutants

    • Site-directed mutagenesis to modify specific domains or residues

    • Compare knock-down versus knock-out effects (as seen in C. reinhardtii ATPG mutants where knock-down allows small accumulation of functional ATP synthase while knock-out completely prevents ATP synthase function)

  • Functional assays:

    • Measure ATP synthesis rates in isolated chloroplasts or thylakoid membranes

    • Assess proton gradient formation using pH-sensitive fluorescent probes

    • Analyze electron transport rates using oxygen electrode or fluorescence techniques

  • Structural biology approaches:

    • Cryo-electron microscopy to visualize ATP synthase architecture

    • Cross-linking studies to map subunit interactions

    • Molecular dynamics simulations to predict structural changes

  • Systems biology integration:

    • Transcriptomics to analyze gene expression changes in atpF mutants

    • Proteomics to identify alterations in chloroplast protein composition

    • Metabolomics to assess impacts on energy metabolism pathways

  • Photosynthetic performance analysis:

    • Chlorophyll fluorescence measurements to assess photosystem efficiency

    • Non-photochemical quenching (NPQ) analysis

    • Assessment of violaxanthin (V) and antheraxanthin (A) accumulation in response to high-light exposure

How can mutations in atpF be designed to investigate specific aspects of ATP synthase function?

Designing mutations in atpF for investigating specific aspects of ATP synthase function requires strategic approaches:

  • Targeting conserved residues:

    • Identify highly conserved amino acids across species

    • Create conservative (similar properties) and non-conservative substitutions

    • Analyze the functional consequences using ATP synthesis assays

  • Domain-specific mutations:

    • Modify transmembrane regions to investigate membrane anchoring

    • Alter regions involved in interactions with other subunits

    • Create chimeric proteins with domains from other species

  • Structure-guided mutagenesis:

    • Use available structural data from related ATP synthases to guide mutation design

    • Focus on residues at interfaces between subunits

    • Consider the Walker A motif (AADSGCGKSTF) which participates in binding the β-phosphate of ATP, and the Walker B motif (EGLHP) where Glu acts as a second ligand for Mg²⁺-ATP

  • Functional motif targeting:

    • Investigate the SFV motif that replaces the typical ASAFAP motif found at the border of signal sequences in Stramenopiles

    • Create mutations in this motif to study its role in protein transport to plastids

    • Conduct site-directed mutagenesis of the Phe residue, which has been shown to be important for protein transport

  • Validation strategies:

    • Express mutant proteins in recombinant systems

    • Assess protein folding and stability

    • Measure binding stoichiometries using fluorescence approaches

    • Test incorporation into ATP synthase complexes

How does Vaucheria litorea atpF compare evolutionarily to homologs in other photosynthetic organisms?

Evolutionary comparison of Vaucheria litorea atpF with homologs in other photosynthetic organisms reveals important insights about structural conservation and functional adaptation:

  • Sequence conservation:

    • Core functional domains are highly conserved across species

    • Variable regions reflect adaptation to specific cellular environments

    • Comparison with other Stramenopiles shows an altered motif SFV instead of the typical ASAFAP at the border of signal sequences

  • Structural evolution:

    • The core architecture of ATP synthase is preserved across diverse photosynthetic lineages

    • Species-specific adaptations are observed in peripheral regions

    • The preservation of key functional motifs, such as the Walker A and B motifs, underscores their essential roles

  • Evolutionary timing:

    • ATP synthase components represent ancient molecular machinery dating back to the primary endosymbiosis (~1.5 billion years ago)

    • Some regulatory features evolved more recently, such as nuclear factors targeting chloroplast mRNAs (e.g., MDE1 targeting atpE 5'UTR evolved in the ancestor of the CS clade of Chlorophyceae, ~300 million years ago)

  • Functional conservation:

    • Despite sequence divergence, the functional role of atpF in maintaining ATP synthase structure is preserved

    • Experimental evidence from C. reinhardtii shows that peripheral stalk subunits are essential for ATP synthase accumulation across species

What can we learn from studying atpF in different algal species about ATP synthase evolution?

Studying atpF across different algal species provides valuable insights into ATP synthase evolution:

  • Structural adaptations:

    • Comparison between yellow-green algae (like V. litorea) and green algae (like C. reinhardtii) reveals conserved structural elements

    • Adaptations in peripheral stalk components reflect environmental niches and metabolic requirements

  • Regulatory mechanisms:

    • Diverse mechanisms have evolved to control ATP synthase assembly and function

    • Nuclear-encoded factors (like MDE1 in C. reinhardtii) regulate chloroplast gene expression differently across algal lineages

    • These mechanisms exemplify the nucleus/chloroplast interplay that evolved over evolutionary time

  • Stress responses:

    • Different algal species have evolved varied responses to environmental stressors

    • High-light tolerance mechanisms often involve adjustments to ATP synthase function

    • In some species, light-harvesting proteins show altered abundance under high-light stress, affecting energy flow to ATP synthase

  • Intron evolution:

    • The presence and processing of introns in atpF transcripts vary across species

    • In vitro splicing systems have revealed mechanisms of intron removal in chloroplast transcripts

    • These differences reflect the evolutionary history of different algal lineages

What are common challenges in working with recombinant atpF and how can they be addressed?

Researchers working with recombinant atpF often encounter several challenges that can be addressed with specific methodological approaches:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and expression conditions

    • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

    • Optimize IPTG concentration and induction temperature/time

  • Protein insolubility:

    • Modify buffer conditions (pH, salt concentration, additives)

    • Include mild detergents for membrane-associated regions

    • Consider using Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Express truncated versions lacking highly hydrophobic regions

  • Protein instability:

    • Add stabilizing agents such as glycerol (5-50%) to storage buffers

    • Aliquot the protein to avoid repeated freeze-thaw cycles

    • Store at -20°C/-80°C for long-term preservation

    • Keep working aliquots at 4°C for up to one week

  • Functional assessment challenges:

    • Use complementary techniques to verify activity

    • Establish positive controls using well-characterized homologs

    • Consider fluorescence-based assays for interaction studies

    • Measure binding stoichiometries for ATP analogs and NADH

How can researchers optimize in vitro systems for studying atpF mRNA splicing?

To optimize in vitro systems for studying atpF mRNA splicing, researchers should consider:

  • Pre-mRNA substrate preparation:

    • Design gene fragments with appropriate flanking sequences

    • Use two successive PCR amplifications to generate templates

    • Incorporate T7 promoter for efficient in vitro transcription

    • Clone into suitable vectors (e.g., pIVS) with appropriate restriction sites

  • Chloroplast extract preparation:

    • Optimize extraction conditions to preserve splicing factors

    • Test different plant/algal sources for extract preparation

    • Include protease inhibitors to prevent degradation

    • Standardize protein concentration in extracts

  • Reaction optimization:

    • Adjust buffer composition, pH, and salt concentration

    • Optimize magnesium concentration, critical for ribozyme activity

    • Test different temperatures and incubation times

    • Include proper controls (no extract, no pre-mRNA)

  • Detection improvements:

    • Use RT-PCR-based methods for sensitive detection

    • Design primers to specifically amplify spliced products

    • Consider using fluorescently labeled primers for quantification

    • Verify spliced mRNA size (approximately 340 nt for atpF)

What controls and validation experiments are essential when studying atpF function?

When studying atpF function, the following controls and validation experiments are essential:

  • Expression and purification controls:

    • SDS-PAGE analysis to confirm protein purity (>90%)

    • Western blot verification of tag presence

    • Mass spectrometry confirmation of protein identity

    • Circular dichroism to assess proper folding

  • Functional validation:

    • Binding assays with ATP or fluorescent analogs (TNP-ATP)

    • Measurement of binding stoichiometry using fluorescence titration

    • Verification of NADH binding capacity where relevant

    • Interaction studies with other ATP synthase components

  • Genetic complementation:

    • Rescue experiments in atpF mutant backgrounds

    • Assessment of ATP synthase complex formation

    • Measurement of ATP synthesis rates

    • Analysis of photosynthetic parameters

  • Mutational controls:

    • Include conservative and non-conservative mutations

    • Test mutations in different domains separately

    • Include well-characterized positive controls

    • Create structure-based mutations with predictable outcomes

    • Compare knock-down versus knock-out effects as seen in C. reinhardtii studies

  • Specificity controls for in vitro splicing:

    • Reactions lacking chloroplast extract

    • Reactions without pre-mRNA

    • Mutations in known splicing elements (like domain V)

    • Time-course analysis to track reaction progress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.