Recombinant Vaucheria litorea ATP synthase subunit b', chloroplastic (atpG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant ATP Synthase Subunit b' (atpG)

The recombinant ATP synthase subunit b', chloroplastic (atpG), is a nuclear-encoded protein expressed in Vaucheria litorea, a yellow-green alga belonging to the Stramenopiles. This subunit is critical for the peripheral stalk of the chloroplast ATP synthase complex, which facilitates proton translocation and ATP synthesis during photosynthesis . The recombinant form is produced in E. coli as a fusion protein with an N-terminal His tag, enabling efficient purification via metal affinity chromatography.

ParameterValue
UniProt IDB7T1R9
Gene NameatpG
SynonymsATP synthase subunit b', chloroplastic; ATPase subunit II
Source OrganismVaucheria litorea (Stramenopiles, secondary endosymbiosis lineage)
Expression SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1–154 aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)

Amino Acid Sequence and Motifs

The recombinant atpG protein (B7T1R9) contains 154 amino acids, with a predicted molecular weight of ~17.3 kDa. Key structural features include:

  • Walker A and B Motifs: Critical for ATP binding and catalysis, with conserved residues (e.g., Ser in Walker A, Glu in Walker B) .

  • Plastid Targeting Sequence: Absent in the mature protein, as nuclear-encoded plastid proteins in Stramenopiles often lack N-terminal transit peptides due to secondary endosymbiosis .

Amino Acid Sequence (Partial):
MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANN LQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLN QTINNFDSEKEKILTSLDEEINSLSSEIITKIVA

Peripheral Stalk Assembly

The atpG subunit (b') forms part of the peripheral stalk, which stabilizes the ATP synthase complex and couples proton translocation to ATP synthesis. In Vaucheria litorea, the plastid genome lacks genes for the γ-subunit (atpH) and other core components, necessitating nuclear-encoded subunits like atpG for functional ATP synthase assembly .

Comparative Insights from Chlamydomonas reinhardtii

Studies in Chlamydomonas reveal that:

  • atpF (subunit b) and atpG (subunit b') are essential for ATP synthase stability .

  • Mutants lacking functional atpG show impaired ATP synthase accumulation and photosynthetic activity .

Expression and Yield

  • Host: E. coli (T7 Express lysY/I q system) .

  • Induction: IPTG (1 mM) .

  • Purification: His-tag affinity chromatography followed by SDS-PAGE validation .

Functional Studies in Plastid Biology

  • Kleptoplasty: Vaucheria litorea plastids are retained in Elysia chlorotica sea slugs for photosynthesis. The recombinant atpG protein aids in studying plastid autonomy and nuclear-plastid interactions .

  • ROS Management: Low singlet oxygen production in Vaucheria plastids may relate to optimized ATP synthase efficiency, reducing oxidative stress .

Biotechnological Potential

  • Structural Analysis: Recombinant atpG facilitates in vitro studies of ATP synthase assembly and proton translocation mechanisms .

  • Gene Expression Models: The nuclear-encoded atpG gene exemplifies evolutionary adaptations in secondary plastid genomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
atpF2; atpG; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Vaucheria litorea (Yellow-green alga)
Target Names
atpG
Target Protein Sequence
MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANN LQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLN QTINNFDSEKEKILTSLDEEINSLSSEIITKIVA
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous F(1) catalytic core and the membrane-bound F(0) proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b'-subunit, a component of the F(0) channel and part of the peripheral stalk, links F(1) and F(0). It is a divergent, duplicated form of the b-subunit found in plants and photosynthetic bacteria.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Vaucheria litorea ATP synthase subunit b' (atpG)?

ATP synthase subunit b', chloroplastic (atpG) is a component of the F0 sector of ATP synthase in the chloroplast of Vaucheria litorea, a yellow-green alga. The protein consists of 154 amino acids with a full-length sequence of MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA . As part of the F0 sector, this protein plays a crucial role in the proton channel formation that facilitates ATP synthesis by allowing proton movement across the membrane, thereby contributing to the chemiosmotic process that generates ATP in chloroplasts.

How is recombinant Vaucheria litorea atpG protein typically produced for research purposes?

Recombinant Vaucheria litorea atpG protein is primarily produced using E. coli expression systems, with the full-length protein (1-154 amino acids) commonly fused to an N-terminal His tag to facilitate purification . The expression process involves transforming E. coli with a plasmid containing the atpG gene sequence, inducing protein expression, lysing the cells, and purifying the protein using affinity chromatography that targets the His tag. The purified protein is then typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . Alternative expression systems including yeast, baculovirus, and mammalian cells are also available for researchers requiring different post-translational modifications or improved folding characteristics .

What storage conditions are recommended for maintaining recombinant atpG protein stability?

For optimal stability, recombinant atpG protein should be stored at -20°C or -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles which can compromise protein integrity . Working aliquots may be stored at 4°C for up to one week . The protein is typically provided in a stabilizing buffer containing Tris/PBS base with 6% trehalose at pH 8.0 , or alternatively in a Tris-based buffer with 50% glycerol . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and then reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) for long-term storage .

What are the recommended protocols for reconstituting lyophilized recombinant atpG protein?

For optimal reconstitution of lyophilized atpG protein, researchers should follow a systematic protocol: First, centrifuge the vial briefly to collect the product at the bottom. Then, reconstitute in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage stability, add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) . Gentle mixing through inversion rather than vortexing helps maintain protein structure. Following reconstitution, the solution should be divided into working aliquots to prevent repeated freeze-thaw cycles. It is advisable to perform a small-scale test reconstitution first to optimize conditions for specific downstream applications, as buffer components may affect experimental outcomes .

How can researchers verify the functional activity of recombinant atpG protein in experimental systems?

Verification of functional activity for recombinant atpG protein requires multiple complementary approaches. Since atpG is a subunit of ATP synthase F0 sector, researchers can assess its ability to incorporate into membrane complexes using liposome reconstitution experiments followed by proton flux measurements. ATP synthase activity assays measuring ATP hydrolysis (reverse reaction) can be performed using colorimetric phosphate detection methods or coupled enzyme assays. Native gel electrophoresis or size exclusion chromatography can demonstrate proper complex assembly when combined with wild-type components. For structural integrity assessment, circular dichroism spectroscopy provides information about secondary structure, while thermal shift assays indicate stability under different buffer conditions. Importantly, comparative analyses against native ATP synthase preparations establish benchmarks for recombinant protein functionality .

What controls should be included when using recombinant atpG in protein-protein interaction studies?

When designing protein-protein interaction studies with recombinant atpG, multiple controls are essential: (1) Tag-only control—using the His-tag alone without the atpG protein to identify tag-mediated false positives; (2) Denatured protein control—to distinguish between specific interactions requiring proper protein folding versus non-specific binding; (3) Competitive binding assays—using excess unlabeled protein to demonstrate specificity; (4) Known interactor controls—including other ATP synthase subunits with established interactions with atpG; (5) Non-related protein controls—using proteins of similar size/charge but unrelated function to identify non-specific binding; (6) Buffer compatibility testing—as components like detergents, salt concentration, and pH can significantly affect interaction results. Additionally, researchers should consider testing both the N-terminal His-tagged version and, if available, untagged versions to confirm that the tag does not interfere with interaction sites .

How can recombinant Vaucheria litorea atpG be used to study horizontal gene transfer between V. litorea and Elysia chlorotica?

Recombinant Vaucheria litorea atpG provides a powerful tool for investigating the remarkable horizontal gene transfer (HGT) between V. litorea and the sea slug Elysia chlorotica. Researchers can use the recombinant protein to generate specific antibodies for immunolocalization studies in sea slug tissues, confirming expression and cellular localization of the algal protein in animal cells. These antibodies can also be employed in Western blot analyses comparing native sea slug proteins with the recombinant algal reference. For structural studies, recombinant atpG enables comparative analyses of post-translational modifications between algal and sea slug versions of the protein, potentially revealing adaptations that occurred post-transfer. Furthermore, in vitro functional assays using recombinant atpG can assess whether the protein maintains functionality in animal cellular environments, particularly regarding its ability to interact with other ATP synthase components . The recombinant protein also serves as a positive control in fluorescent in situ hybridization experiments that localize the transferred gene in sea slug chromosomes, as demonstrated with the successful localization of another algal gene (prk) to a metaphase chromosome in slug larvae .

What methodologies can be employed to study the structural differences between atpG from V. litorea and homologous proteins from other species?

Comparative structural analysis of V. litorea atpG with homologs from other species requires a multi-technique approach. X-ray crystallography or cryo-electron microscopy can resolve high-resolution three-dimensional structures, revealing species-specific structural adaptations. When these are unavailable, homology modeling using the amino acid sequence (MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA) against known ATP synthase structures provides valuable structural predictions . For experimental approaches, hydrogen-deuterium exchange mass spectrometry can identify regions with differential solvent accessibility between species. Circular dichroism spectroscopy quantifies secondary structure content, while thermal stability assays measure unfolding temperatures that may differ between homologs. Crosslinking mass spectrometry can map interaction interfaces with partner proteins, potentially revealing species-specific binding patterns. Comparing V. litorea atpG (154 aa) with homologs such as Ochrosphaera neapolitana atpG (163 aa, sequence: MNLFSMPLGQMLALSEGEGGLFDFNATLPLMALQFILLTVILTFVFYKPIGNLLEEREAYINGNLSDASAKLLQADELCKQYEEQLKDAKADAQSCIADAETEAKQVVALELAQARKDAASLVEQVNKELEAQKELALKQLEAQIDELSQLIKEKLLGKQAIL) enables identification of conserved domains versus variable regions that may reflect environmental adaptations .

What are the challenges and techniques for incorporating recombinant atpG into functional ATP synthase complexes in vitro?

Reconstituting functional ATP synthase complexes with recombinant atpG presents several significant challenges. The hydrophobic nature of atpG, indicated by its transmembrane regions in the amino acid sequence, necessitates careful detergent selection for solubilization without disrupting native structure . Researchers typically employ a stepwise assembly approach, first forming subcomplexes of the F0 sector (including atpG) before integration with F1 components. Liposome reconstitution is crucial for providing the lipid bilayer environment required for proper function, with lipid composition significantly affecting activity. Precise stoichiometric ratios of all ATP synthase subunits must be maintained, often requiring co-expression systems or sequential addition protocols with purification steps between additions. Activity verification requires specialized techniques such as ATP synthesis assays driven by artificial proton gradients or patch-clamp electrophysiology to measure proton conductance. When working with recombinant atpG specifically, researchers must account for potential interference from the His-tag, either by incorporating a cleavage site or confirming that the tagged version maintains function in control experiments .

What are common issues encountered when working with recombinant atpG protein and how can they be addressed?

When working with recombinant Vaucheria litorea atpG protein, researchers commonly encounter several challenges. Protein aggregation frequently occurs due to atpG's hydrophobic transmembrane regions (visible in the sequence MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYT...) . This can be addressed by using mild detergents such as DDM or CHAPS during purification and storage, or by adjusting buffer conditions to include stabilizing agents beyond the standard 6% trehalose . Poor solubility after reconstitution may result from inadequate centrifugation before opening the vial or improper reconstitution technique; researchers should ensure thorough centrifugation and consider sonication or gentle warming to enhance solubilization . Reduced activity in functional assays might indicate protein denaturation during freeze-thaw cycles, emphasizing the importance of proper aliquoting and avoiding repeated freezing and thawing . Interference from the His-tag in interaction studies can be addressed by comparing tagged and untagged versions or including appropriate controls . For long-term storage stability issues, the glycerol concentration in storage buffers can be optimized between 5-50%, with higher concentrations generally providing better protection against freeze-damage .

How can researchers distinguish between native and recombinant forms of atpG in experimental systems?

Distinguishing between native and recombinant forms of atpG requires strategic experimental approaches. The most straightforward method leverages the His-tag present on the recombinant protein (MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNI...) , enabling detection via anti-His antibodies in Western blots, immunoprecipitation, or immunofluorescence experiments. Size-based discrimination is possible through SDS-PAGE or size exclusion chromatography, as the recombinant His-tagged version will have a slightly higher molecular weight than the native protein. Mass spectrometry provides definitive identification through detection of tag-specific peptides and any potential post-translational modifications present in native but absent in recombinant forms. For functional distinctions, researchers can employ competitive activity assays where recombinant protein may demonstrate subtle differences in kinetic parameters compared to native protein. Additionally, thermal stability analysis often reveals differences, as recombinant proteins may exhibit altered denaturation profiles compared to their native counterparts due to minor structural differences or absence of stabilizing post-translational modifications .

What considerations should be taken into account when designing antibodies against atpG for research applications?

Designing effective antibodies against atpG requires careful consideration of several factors. Epitope selection is critical—researchers should analyze the amino acid sequence (MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA) to identify regions with high antigenicity scores while avoiding transmembrane domains (approximately the first third of the sequence contains hydrophobic stretches likely embedded in the membrane). Hydrophilic, surface-exposed regions make better antigens, typically found in the C-terminal portion of the protein. Cross-reactivity must be assessed—sequence alignment with homologous proteins from related species helps identify unique regions specific to V. litorea atpG, particularly important when studying horizontal gene transfer between V. litorea and Elysia chlorotica . For applications requiring native protein detection, conformational epitopes may be preferable, necessitating immunization with properly folded protein rather than linear peptides. When developing antibodies against His-tagged recombinant atpG, researchers should consider whether the antibody will be used to detect tagged or untagged protein in subsequent experiments, potentially developing separate antibodies against the tag and protein regions. Finally, validation protocols should include Western blots against both recombinant and native protein sources, immunoprecipitation tests, and pre-absorption controls with the immunizing antigen .

What insights does the study of V. litorea atpG provide into the evolution of chloroplast ATP synthase in different photosynthetic organisms?

The study of Vaucheria litorea atpG offers valuable insights into chloroplast ATP synthase evolution across diverse photosynthetic lineages. V. litorea, as a yellow-green alga (ochrophyte), represents a distinct evolutionary branch from green algae and plants, having acquired chloroplasts through secondary endosymbiosis of a red algal ancestor . Comparative sequence analysis of V. litorea atpG (MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA) with those from other photosynthetic organisms reveals conservation of core functional domains despite divergent evolutionary histories . This conservation underscores the fundamental importance of ATP synthase structure across photosynthetic lineages despite billions of years of separate evolution. The protein's 154-amino acid length falls within the typical range for this subunit across species, suggesting structural constraints on size variation . Most significantly, V. litorea atpG has become central to understanding horizontal gene transfer between kingdoms, as exemplified by its transfer to the sea slug Elysia chlorotica. This extraordinary evolutionary event—where an animal acquires and maintains a functional plant gene—demonstrates unexpected plasticity in genomic inheritance patterns and challenges conventional understanding of evolutionary mechanisms .

What role might horizontal gene transfer of atpG play in the evolutionary adaptation of organisms like Elysia chlorotica?

The horizontal gene transfer (HGT) of atpG and other chloroplast-related genes from Vaucheria litorea to the sea slug Elysia chlorotica represents a remarkable evolutionary innovation with profound adaptive significance. This gene transfer, confirmed through fluorescent in situ hybridization localizing algal nuclear genes to slug chromosomes, enables E. chlorotica to maintain functional chloroplasts (kleptoplasts) sequestered from its algal food source for extended periods—up to 9-10 months without additional feeding . The acquisition of atpG, which encodes an essential component of ATP synthase, provides the slug with the genetic machinery to maintain energy production in these sequestered chloroplasts. This unique adaptation transforms the slug from a strict heterotroph to a partial autotroph capable of photosynthesis, representing an extraordinary evolutionary shortcut compared to the conventional endosymbiotic process that required millions of years to evolve chloroplasts in algae and plants . From an evolutionary perspective, this represents a form of rapid adaptive evolution that confers immediate fitness benefits by reducing dependence on continuous food sources. The success of this HGT event also provides insights into the mechanisms and constraints governing cross-kingdom gene transfers, suggesting that under specific ecological pressures, such evolutionary innovations may be more feasible than previously thought .

What emerging technologies might enhance our understanding of atpG structure and function in chloroplast ATP synthase?

Emerging technologies promise to revolutionize our understanding of atpG's role in chloroplast ATP synthase. Cryo-electron microscopy advancements now allow visualization of membrane proteins at near-atomic resolution without crystallization, potentially revealing how atpG (sequence: MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANNLQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLNQTINNFDSEKEKILTSLDEEINSLSSEIITKIVA) interacts with other ATP synthase components in its native environment . AlphaFold2 and other AI-powered structure prediction algorithms can generate highly accurate models of atpG's tertiary structure and its position within the complete ATP synthase complex. Single-molecule biophysics techniques like magnetic tweezers and optical traps may elucidate the mechanical contributions of atpG to the rotary mechanism of ATP synthase. CRISPR-Cas9 gene editing in algal models could enable precise manipulation of specific atpG residues to correlate sequence variations with functional outcomes. Time-resolved spectroscopy techniques might capture conformational changes in atpG during the catalytic cycle, while hydrogen-deuterium exchange mass spectrometry could map dynamic protein-protein interactions. Nanopore technologies could potentially measure proton conductance through reconstituted F0 sectors containing recombinant atpG, directly assessing its contribution to proton translocation .

How might research on V. litorea atpG contribute to understanding and engineering bioenergetic processes in synthetic biology applications?

Research on Vaucheria litorea atpG holds significant potential for advancing synthetic biology applications targeting bioenergetic processes. The protein's detailed structural analysis and function as part of the proton channel in ATP synthase provide a blueprint for designing artificial energy-harvesting systems . Bioengineers could potentially incorporate modified versions of atpG into synthetic ATP synthase complexes with enhanced efficiency or altered specificity. The compact size of atpG (154 amino acids) makes it amenable to optimization through directed evolution approaches, potentially yielding variants with improved stability or activity under non-physiological conditions . Researchers studying the horizontal gene transfer of atpG between V. litorea and Elysia chlorotica have identified mechanisms for successfully integrating chloroplast-related genes into non-plant genomes, providing valuable insights for engineering photosynthetic capabilities in heterologous hosts . This knowledge could inform strategies for creating hybrid systems that combine parts of photosynthetic and non-photosynthetic organisms. Additionally, understanding how atpG maintains functionality across different cellular environments may guide the development of robust bioenergetic components for synthetic cells or bioreactors designed to function under varying conditions .

What are the potential applications of understanding the horizontal gene transfer of atpG for biotechnology and evolutionary studies?

The horizontal gene transfer (HGT) of atpG from Vaucheria litorea to Elysia chlorotica represents a natural genetic engineering phenomenon with far-reaching implications for biotechnology and evolutionary biology. For biotechnology applications, this system provides a proven model for transferring functional chloroplast-related genes across kingdom boundaries, potentially informing strategies for engineering photosynthetic capabilities in non-plant organisms for biofuel production or carbon sequestration . The mechanisms enabling successful integration and expression of algal genes in animal genomes could guide the development of novel vectors or methods for cross-kingdom genetic engineering. From an evolutionary perspective, studying the transferred atpG gene offers insights into the molecular and cellular conditions that facilitate rare HGT events, helping to resolve debates about the frequency and significance of HGT in eukaryotic evolution . Comparative genomic analyses between the original algal atpG and its sea slug counterpart may reveal adaptive mutations that emerged post-transfer, illuminating molecular adaptation processes. Furthermore, this research informs conservation biology by highlighting unique evolutionary innovations in marine organisms that might be threatened by changing ocean conditions . The methodologies developed for detecting and confirming HGT events, such as fluorescent in situ hybridization techniques, provide valuable tools for identifying similar genetic transfers in other organisms, potentially uncovering previously unrecognized instances of cross-kingdom gene exchange .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.