Recombinant Venezuelan equine encephalitis virus Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The recombinant Venezuelan equine encephalitis virus (VEEV) structural polyprotein is a genetically engineered protein complex derived from the structural genes of VEEV, typically expressed within recombinant viral vectors or vaccine platforms. This polyprotein is post-translationally cleaved into functional subunits: the capsid protein and envelope glycoproteins E2 and E1, which mediate viral assembly, host cell entry, and immune evasion .

Key Features of Recombinant Constructs:

ComponentSource VirusFunction in Recombinant Systems
Nonstructural proteinsSindbis virus (SINV)Provide replication machinery (nsP1–4)
Structural polyproteinVEEV TC-83 strainGenerates capsid, E2, and E1 for virion assembly
Regulatory elementsSINV 5′/3′ UTRsOptimize RNA replication and translation

Examples include the SIN-83 chimeric virus, which combines SINV’s replicative enzymes with VEEV’s structural genes to enhance safety and immunogenicity .

3.1. Attenuation Mechanisms

  • Nuclear transport inhibition: The VEEV capsid binds importin-α/β and CRM1 receptors, blocking host transcription and antiviral responses . Recombinant variants with mutations in the capsid’s nuclear localization signal (NLS) reduce neurovirulence while retaining immunogenicity .

  • Proteolytic processing: The nsP2 protease cleaves the structural polyprotein. Mutations in nsP2 (e.g., Ser795→Thr) stabilize replication and attenuate pathogenicity .

3.2. Immune Evasion

  • Capsid-mediated transcriptional shutoff: Disrupts host mRNA export, suppressing interferon responses .

  • Subgenomic RNA optimization: Recombinant constructs like VEEV/mutSG/IRES replace the subgenomic promoter with an IRES element, limiting replication in mosquitoes and enhancing safety .

4.1. Live-Attenuated Vaccines

  • TC-83 strain: The historical VEEV vaccine retains residual virulence. Recombinant derivatives (e.g., SIN-83) eliminate neurotoxicity in mice while inducing neutralizing antibodies .

  • Chimeric platforms: SINV-VEEV hybrids achieve >90% protection in challenge studies with pathogenic VEEV strains .

4.2. Subunit Vaccines

  • Recombinant vaccinia/VEEV: Expresses E2 and E1 glycoproteins, eliciting neutralizing antibodies in preclinical models .

Challenges and Limitations

  • Genetic instability: Spontaneous mutations (e.g., plaque size variants in SIN-83S) may compromise safety profiles .

  • Host-specific effects: Capsid interactions with nuclear pore complexes vary between species, complicating translational research .

Future Directions

  • Therapeutic targeting: Inhibitors of capsid-CRM1 interactions (e.g., SINE compounds) reduce viral replication and cytopathic effects .

  • Multi-valent vaccines: Combining structural genes from multiple alphaviruses (e.g., SINV, EEEV) could broaden protection .

Key Research Findings

Study FocusOutcomeSource
SIN-83 attenuationNo disease in mice; 100% survival post-challenge
Capsid-NPC interactionBlocks nuclear import, enhancing virulence
IRES-based constructsReduces mosquito transmission risk
nsP2 specificityIdentified P1′ preferences for substrate cleavage

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
813-1254
Protein Length
Full Length of Mature Protein
Species
Venezuelan equine encephalitis virus (strain TC-83) (VEEV)
Target Protein Sequence
YEHATTMPSQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPAI KCCGSQECTPTYRPDEQCKVFTGVYPFMWGGAYCFCDTENTQVSKAYVMKSDDCLADHAE AYKAHTASVQAFLNITVGEHSIVTTVYVNGETPVNFNGVKITAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQSRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELTEQGSATIHFSTAN IHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATIVAMYVLTNQKHN
Uniprot No.

Target Background

Function
The Venezuelan equine encephalitis virus (VEEV) structural polyprotein assembles into an icosahedral capsid (T=4 symmetry) comprising 240 copies of the capsid protein. This capsid is enveloped by a lipid membrane containing 80 spikes, each formed by E1-E2 heterodimer trimers. The capsid protein binds viral RNA near a ribosome binding site, facilitating translation post-genome release. It possesses protease activity, autocatalytically cleaving from the nascent structural protein. Following self-cleavage, it transiently interacts with ribosomes before binding viral RNA and rapidly assembling into icosahedral core particles. The nucleocapsid then associates with the cytoplasmic domain of the E2 spike glycoprotein at the cell membrane, leading to budding and virion formation. During infection, virions attach to target cells, undergoing clathrin-mediated endocytosis and fusion with the host endosomal membrane. This releases the nucleocapsid into the cytoplasm, triggering uncoating (possibly via capsid-ribosome interaction) to expose the genomic RNA. The protein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, evading innate immune detection before gene expression. It also inhibits host transcription by forming a tetrameric complex with XPO1/CRM1 and importin, blocking nuclear pore channels and inhibiting receptor-mediated nuclear transport of host mRNA and rRNA. This transcriptional inhibition contributes to the cytopathic effect. The polyprotein provides the signal sequence for E3/E2 precursor translocation to the endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, protecting it during secretory pathway transport. After virion release, E3 is gradually released extracellularly. E2, involved in cell receptor binding, is synthesized as a p62 precursor. Furin processing at the cell membrane before budding generates the E2-E1 heterodimer (unstable, dissociating at low pH), leaving the stable p62-E1 heterodimer. The final p62 processing likely prevents premature E1 fusion activation. E2's C-terminus contains a transient transmembrane domain, disrupted by palmitoylation, reorienting the C-terminal tail from lumenal to cytoplasmic side. This is crucial as the cytoplasmic E2 C-terminus interacts with capsid proteins during budding. This cytoplasmic release occurs late in protein export, preventing premature particle assembly at the ER membrane. The 6K protein, a constitutive membrane protein, is involved in glycoprotein processing, cell permeabilization, and virion budding. It disrupts calcium homeostasis, likely at the ER, leading to cytoplasmic calcium elevation. Its lipophilic nature suggests influence on lipid selection around glycoprotein transmembrane domains, impacting bilayer deformability needed for budding. It constitutes ~3% of virions. E1 is a class II viral fusion protein. Its fusion activity is inactive when bound to E2 in mature virions. Endosomal acidification post-cell entry dissociates the E1/E2 heterodimer, triggering E1 trimerization and fusion activity. This facilitates nucleocapsid release following endosome-viral membrane fusion. Efficient fusion requires cholesterol and sphingolipids in the target membrane, optimally with a 1:2 cholesterol:phospholipid ratio, specifically requiring sterols with a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the Venezuelan equine encephalitis virus and how is it classified?

Venezuelan equine encephalitis virus is an alphavirus belonging to the encephalitic category of the alphavirus family. VEEV is an enveloped, arthropod-transmitted single-stranded positive-sense RNA virus that infects various vertebrate hosts including humans, horses, rodents, birds, and fish . It causes meningitis, encephalitis, and long-term neurological sequelae in survivors, distinguishing it from arthritogenic alphaviruses like chikungunya (CHIKV) which primarily cause arthritis and musculoskeletal diseases . The global distribution of alphaviruses, including VEEV, has expanded in recent decades due to international travel, expansion of mosquito vectors, deforestation, and urbanization .

What are the primary components of the VEEV structural polyprotein?

The VEEV structural polyprotein is composed of the capsid protein and two major glycoproteins, E1 and E2 . The capsid protein forms the nucleocapsid that encapsulates the viral genome, while E1 and E2 glycoproteins form heterodimers that appear as trimeric spikes on the viral surface . The structural polyprotein undergoes post-translational processing by both viral and host proteases to generate these individual proteins. The capsid protein exhibits protease activity required for the initial processing of the structural polyprotein . The E2 glycoprotein contains important antigenic determinants and is involved in receptor binding, while E1 contains the fusion peptide necessary for viral entry .

How does the VEEV capsid protein function in viral replication?

The VEEV capsid protein is multifunctional, exhibiting several critical roles during viral infection. It selectively packages the viral genome into viral particles while excluding cellular or viral subgenomic RNA . Additionally, the capsid protein possesses protease activity essential for processing the structural polyprotein . A unique function of VEEV capsid protein is its ability to inhibit cellular nuclear import processes. It forms a tetrameric complex with the nuclear export receptor CRM1 and nuclear import receptor importin α/β, which accumulates in the nuclear pore complex (NPC) channel and blocks nuclear import mediated by different karyopherins . This inhibitory function is determined by a short 39-amino-acid peptide containing both nuclear import and supraphysiological nuclear export signals . This mechanism contributes to the cytotoxicity of VEEV capsid protein and its ability to disrupt host cellular functions.

What receptor does VEEV use for host cell entry?

VEEV uses LDLRAD3 (low-density lipoprotein receptor class A domain-containing 3) as an attachment and entry receptor . Recent cryo-electron microscopy reconstructions have revealed that domain 1 of LDLRAD3, which is a low-density lipoprotein receptor type-A module, binds to VEEV by wedging into a cleft created by two adjacent E2-E1 heterodimers in one trimeric spike . This interaction engages domains A and B of the E2 glycoprotein and the fusion loop in E1 . VEEV engages LDLRAD3 in a manner similar to how arthritogenic alphaviruses bind to the structurally unrelated MXRA8 receptor, but with a notably smaller interface . Understanding this receptor interaction is crucial for developing targeted therapeutics against VEEV infection.

What techniques are used to create recombinant VEEV systems for research?

Several advanced methodologies are employed to create recombinant VEEV systems. One established approach involves inserting cDNA molecules encoding VEEV structural proteins under the control of a viral promoter into a vector virus. For example, researchers have inserted cDNA encoding structural proteins from both virulent Trinidad donkey and attenuated TC-83 vaccine strains of VEEV under the vaccinia virus 7.5K promoter into the thymidine kinase gene of vaccinia virus . This creates recombinant vaccinia/VEE viruses that express VEEV structural proteins.

Another methodology employs VEEV-based virus replicon particles (VRPs) that encapsulate self-amplifying VEEV replicon RNA vectors lacking structural genes . These replicon systems can be engineered to express fluorescent markers like mCherry or eGFP in place of structural genes, allowing visualization of replicon RNA amplification through fluorescence microscopy . These systems enable researchers to study viral replication without producing infectious virus particles, providing a safer platform for investigating viral protein functions and interactions.

How can researchers verify the expression and functionality of recombinant VEEV structural proteins?

Verification of recombinant VEEV structural protein expression and functionality involves multiple complementary techniques. Immunoblotting of lysates from cells infected with recombinant vaccinia/VEE viruses can demonstrate synthesis of the capsid protein and glycoproteins E2 and E1 . Fluorescent antibody (FA) analysis using panels of VEEV-specific monoclonal antibodies can detect expressed glycoproteins and confirm the presence of specific epitopes . In studies with the recombinant vaccinia/VEE virus system, seven E2-specific epitopes and two of four E1-specific epitopes were successfully demonstrated by FA analysis .

For functional studies, researchers can employ single-cell imaging techniques with fluorescent reporter-expressing replicons to monitor viral RNA replication dynamics in real-time . Additionally, superinfection exclusion assays can assess the functionality of viral proteins by examining their ability to interfere with subsequent viral infections . Protein-protein interaction studies using co-immunoprecipitation or proximity ligation assays can further verify functional interactions between viral and host proteins, providing insights into the structural polyprotein's processing and activity.

What structural analysis techniques have provided insights into VEEV protein interactions?

Near-atomic-resolution cryo-electron microscopy (cryo-EM) has been instrumental in elucidating the structural details of VEEV and its interactions with host receptors. Researchers have obtained reconstructions of VEEV virus-like particles both alone and in complex with the ectodomains of the LDLRAD3 receptor . These high-resolution structural analyses have revealed the precise binding interface between VEEV glycoproteins and LDLRAD3, showing how domain 1 of LDLRAD3 wedges into a cleft created by adjacent E2-E1 heterodimers and engages domains A and B of E2 and the fusion loop in E1 .

The atomic modeling of this interface has been supported by complementary techniques including mutagenesis and anti-VEEV antibody binding competition assays . These structural studies have allowed comparative analyses with other alphavirus-receptor interactions, revealing both conserved binding principles and virus-specific adaptations. For instance, VEEV engages LDLRAD3 in a manner similar to how arthritogenic alphaviruses bind to the structurally unrelated MXRA8 receptor, but with a significantly smaller interface . Such structural insights are essential for understanding viral tropism and developing targeted antiviral strategies.

What cell models are optimal for studying recombinant VEEV structural polyprotein expression?

When designing experiments to study recombinant VEEV structural polyprotein expression, researchers should carefully consider cell model selection based on experimental objectives. Vero cells (African green monkey kidney cells) are commonly used for VEEV studies as demonstrated in multiple investigations . These cells support robust VEEV replication and are amenable to transduction with VEEV replicon particles and visualization techniques . CV-1 cells have also been successfully used in recombinant vaccinia/VEEV virus infection studies for demonstrating structural protein expression .

For studies focusing on neurotropism and pathogenesis mechanisms, neuronal cell lines or primary neuronal cultures may provide more relevant cellular contexts, given VEEV's neurological disease manifestations. When investigating host-pathogen interactions or immune responses, human cell lines relevant to natural infection sites (such as dermal fibroblasts, endothelial cells, or neuronal cells) should be considered. Researchers should evaluate each cell model for permissiveness to VEEV replication, capacity for protein expression, and relevance to the specific aspects of viral biology being investigated.

How can researchers differentiate between effects of individual structural proteins versus the complete polyprotein?

To distinguish between effects mediated by individual structural proteins versus the complete polyprotein, researchers can employ several strategic approaches. One effective method involves designing expression constructs for individual proteins (capsid, E1, E2) and comparing their effects to those of the complete structural polyprotein . For example, transient expression of individual viral proteins can reveal their specific functions, as demonstrated in studies showing that the VEEV nsP3 (but not nsP2) could reduce alphavirus replication, implicating nsP3 in superinfection exclusion mechanisms .

Domain mapping and mutagenesis studies are also valuable for identifying functional regions within proteins. Research on VEEV capsid protein identified a short 39-amino-acid peptide that determines its inhibitory function in nuclear import . Comparative analysis between wild-type and mutant proteins can further elucidate structure-function relationships. When designing such experiments, researchers should consider potential differences between individually expressed proteins and those produced through polyprotein processing, as the latter may reflect more authentic post-translational modifications and localization patterns.

What controls are essential when studying recombinant VEEV structural proteins?

Rigorous controls are critical for ensuring experimental validity in VEEV structural protein studies. First, empty vector controls should be included when expressing recombinant proteins to distinguish specific protein effects from vector-induced changes. When using fluorescent reporters to monitor viral replication, single-fluorescent protein controls are essential for establishing baseline expression levels and for proper quantification in co-expression studies .

For recombinant vaccinia/VEE virus studies, wild-type vaccinia virus infection controls help distinguish VEEV protein-specific effects from those caused by the vector virus . When conducting immunological detection of viral proteins, specificity controls using non-immune sera or irrelevant antibodies are necessary to confirm detection specificity . Time-course experiments should include appropriate time-matched controls, particularly important when studying time-dependent processes like superinfection exclusion . In studies examining protein-protein interactions or subcellular localization, researchers should include controls for non-specific binding and background fluorescence to ensure accurate interpretation of results.

How should researchers analyze co-expression data when studying viral protein interactions?

When analyzing co-expression data to study viral protein interactions, researchers face several challenges requiring careful methodological approaches. For fluorescent protein co-expression studies, dedicated image analysis software like CellProfiler can be employed to quantify single and dual-positive cells, as demonstrated in studies of VEEV replicon competition . Statistical analysis should compare observed dual-positive frequencies against theoretical probability predictions to identify significant deviations indicative of interference or synergy between proteins .

For instance, in VEEV replicon co-transduction studies, only 5.5% of cells were dual-positive (expressing both green and red fluorescent proteins), significantly lower than the statistically independent probability prediction of 25% . Such quantitative analysis revealed competition between VEEV replicons that hindered co-replication in the same cell. When analyzing protein-protein interaction data, researchers should consider factors like protein expression levels, subcellular localization patterns, and potential interference from tags or fusion partners. Correlation coefficients, co-localization indices, and quantitative binding measurements provide robust metrics for evaluating interaction strength and specificity.

What challenges exist in interpreting structural data of VEEV proteins and their complexes?

Interpreting structural data of VEEV proteins and their complexes presents several significant challenges. Near-atomic-resolution cryo-EM reconstructions of VEEV virus-like particles provide valuable insights but require careful interpretation, particularly at interfaces between viral components or between viral and host proteins . One challenge involves distinguishing biologically relevant interactions from artifacts introduced during sample preparation or reconstruction processes. Validation through complementary techniques such as mutagenesis and antibody binding competition assays is essential for confirming structural models .

Another challenge lies in interpreting dynamic aspects of protein function from static structural snapshots. VEEV structural proteins undergo conformational changes during receptor binding, membrane fusion, and capsid assembly that may not be captured in a single structural determination. Integrating structural data with functional assays and molecular dynamics simulations can provide a more complete understanding of these dynamic processes. Researchers must also carefully consider physiological relevance when interpreting structural data obtained under experimental conditions that may differ from the natural infection environment.

How can contradictory findings in VEEV research be reconciled?

To address such contradictions, researchers should conduct comparative studies using standardized protocols across different viral strains or subtypes. Careful documentation of experimental conditions, cell types, viral strains, and genetic constructs is essential for meaningful cross-study comparisons. Meta-analysis approaches can identify patterns across studies that may explain seemingly conflicting results. When contradictions arise regarding protein functions, systematic domain mapping and mutagenesis studies can pinpoint specific regions responsible for divergent activities, as demonstrated in research comparing pathogenic and less pathogenic VEEV strains with mutations in the capsid protein's inhibitory peptide .

What are promising therapeutic targets within the VEEV structural polyprotein?

The VEEV structural polyprotein contains several promising therapeutic targets that warrant further investigation. The receptor-binding domain on the E2 glycoprotein that interacts with LDLRAD3 represents a high-priority target . The detailed structural understanding of this interaction interface could guide the design of small molecule inhibitors or peptide mimetics that block viral attachment. The fusion loop within the E1 glycoprotein, which mediates membrane fusion during viral entry, is another attractive target for inhibitor development .

The unique nuclear import inhibition mechanism of the VEEV capsid protein, mediated by a specific 39-amino-acid peptide, presents another compelling therapeutic target . Compounds that disrupt the formation of the unusual tetrameric complex between capsid protein, CRM1, and importin α/β could potentially reduce viral cytopathicity . Given that mutations in this peptide are associated with attenuated phenotypes in less pathogenic VEEV strains, this region appears particularly significant for virulence . Future research should focus on high-throughput screening campaigns against these targets and structure-guided drug design approaches to identify inhibitors with high specificity and potency.

What novel experimental systems could advance VEEV structural polyprotein research?

Several innovative experimental systems hold promise for advancing VEEV structural polyprotein research. Organoid cultures, particularly brain organoids, could provide more physiologically relevant models for studying VEEV neurotropism and structural protein functions in three-dimensional tissue contexts. CRISPR-Cas9 gene editing of host cells could enable precise manipulation of receptor expression and pathways involved in VEEV replication, offering new insights into structural protein-host interactions.

Advanced imaging technologies such as super-resolution microscopy and live-cell single-molecule tracking could reveal dynamic aspects of structural protein functions during viral entry and assembly. Cryo-electron tomography could capture structural protein arrangements in their native cellular environments, complementing existing near-atomic-resolution structures . Development of cell-free protein expression systems optimized for alphavirus structural proteins could facilitate biochemical and biophysical studies without cell culture limitations. Additionally, computational approaches including molecular dynamics simulations and machine learning algorithms could predict structural protein behaviors under different conditions and guide experimental design.

How might comparative studies between VEEV and other alphaviruses advance structural polyprotein research?

Comparative studies between VEEV and other alphaviruses offer valuable opportunities to identify both conserved and unique features of structural polyproteins that could inform therapeutic development and basic virology. Systematic comparison of receptor binding mechanisms between encephalitic alphaviruses (like VEEV) and arthritogenic alphaviruses could reveal adaptations that determine tissue tropism and disease manifestations . The observation that VEEV engages LDLRAD3 similarly to how arthritogenic alphaviruses bind the structurally unrelated MXRA8 receptor, but with a smaller interface, suggests convergent evolutionary solutions worthy of deeper investigation .

Comparative analysis of superinfection exclusion mechanisms between VEEV and other alphaviruses has already revealed intriguing differences, with VEEV employing nsP3 rather than nsP2 as implicated in arthritogenic alphaviruses . Expanding such comparisons to structural proteins could identify virus-specific and conserved mechanisms. Cross-species analysis of capsid protein functions, particularly the nuclear import inhibition mechanism unique to New World alphaviruses like VEEV, could elucidate connections between these functions and pathogenesis . These comparative approaches should incorporate both structural analyses and functional studies to build comprehensive models of alphavirus structural polyprotein evolution and specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.