Recombinant Verminephrobacter eiseniae Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

Lnt transfers an acyl group from sn-1-glycerophospholipids to apolipoproteins via a thioester intermediate . Structural studies of E. coli Lnt homologs reveal:

  • A dynamic periplasmic "arm" regulating substrate access to the active site .

  • Conformational changes triggered by substrate binding, enabling acyl transfer .

In V. eiseniae, Lnt’s activity is vital for:

  • Lipoprotein maturation: Triacylation of lipoproteins ensures proper membrane localization .

  • Host-symbiont interactions: Lipoproteins mediate signaling in earthworm embryos, where V. eiseniae resides .

Research Applications

Recombinant V. eiseniae Lnt is primarily used in:

  • ELISA-based assays: Detecting lipoprotein modifications in bacterial membranes .

  • Functional studies: Investigating antibiotic susceptibility linked to defective lipoprotein biogenesis (e.g., increased outer membrane permeability in lnt mutants) .

  • Comparative enzymology: Contrasting Lnt mechanisms across Gram-negative bacteria (e.g., Acinetobacter, Mycobacteria) .

Genetic and Phenotypic Impact

  • lnt deletion in Acinetobacter species causes cell envelope defects, antibiotic hypersensitivity, and altered morphology .

  • V. eiseniae Lnt mutants show reduced natural transformation efficiency, implicating lipoproteins in DNA uptake via type IV pili .

Species-Specific Adaptations

  • Unlike E. coli Lnt, V. eiseniae Lnt tolerates host-associated genomic rearrangements without losing catalytic efficiency .

  • Substrate specificity for C16 and C19:0 fatty acids mirrors mycobacterial Lnt, suggesting evolutionary conservation in lipid metabolism .

Future Directions

Research priorities include:

  • Resolving the crystal structure of V. eiseniae Lnt to elucidate host-specific adaptations.

  • Engineering Lnt inhibitors to combat antibiotic-resistant infections .

  • Exploring horizontal gene transfer mechanisms in V. eiseniae symbionts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences you may have. Please clearly indicate your requirements when placing your order, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquot the protein to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; Veis_2158; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Verminephrobacter eiseniae (strain EF01-2)
Target Names
lnt
Target Protein Sequence
MARACPSLAWQLPWALVAGLAQAASLAWPWGGEPLWWLQLASMAMLAWLLRPGADRAVAW HRAALIGGVFATAWLASTFWWLFISMHRYGALPAPLAAAAVLVLAAFLASYYAAAMGLFC RLAPLHRAGAALLFGACWLLAELARGSLWTGFPWGAGGYAHADGPLRVLARYVGVYGIGA VAALLALLCVQWRRADLRHWPMWLLLLAGAAALALAAVQRTCAIDLCDTPPPWRRDPTLS VELLQGNIAQDEKFRPGSGVALALQWYGQALRTARAQLVVAPETALPLLPQQLMPGYLEG LARHYAQGPQAALLGIPWGDQATGYTNSVLGLSPATGAMPYRYDKHHLVPFGEFVPPFFK WFTARMQIPLGNFNRAGVGQASFAWAGQRLAPNICYEDLFGEELGARFIDPAQAPTVFVN LSNIGWFGNTIAIDQHLQISRMRALEFERPMVRATNTGATAIIDHRGQVTHQLARHTRGV LRGQVHGRGLDAHSGWAITPYAWWVARWGLWPLWALAALALAWAMRAQRMRRARGA
Uniprot No.

Target Background

Function
Apolipoprotein N-acyltransferase (lnt) from Verminephrobacter eiseniae catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity and structural characterization of Verminephrobacter eiseniae Apolipoprotein N-acyltransferase (lnt)?

Verminephrobacter eiseniae Apolipoprotein N-acyltransferase (lnt) is a membrane-bound enzyme that catalyzes N-acylation using phospholipids as acyl donors, transferring a third acyl group to bacterial lipoproteins. The recombinant form is produced as a truncated protein spanning residues 1-536 of the full-length sequence.

The enzyme can be identified by the following molecular characteristics:

PropertyDetails
SpeciesVerminephrobacter eiseniae (strain EF01-2)
UniProt IDA1WJU9
Genelnt (ordered locus: Veis_2158)
Expression RegionResidues 1–536
Post-Translational ModificationsPredicted diacylglycerol attachment and N-terminal acylation
KEGG Identifiervei:Veis_2158
STRING Identifier391735.Veis_2158

Structurally, the enzyme contains a catalytic cysteine residue (analogous to Cys387 in E. coli Lnt) that is critical for forming a thioester intermediate during acyl transfer. Crystal structures of the homologous E. coli Lnt reveal dynamic loops that regulate substrate access, suggesting a conserved mechanism in V. eiseniae Lnt.

How does the Lnt enzyme function in bacterial lipoprotein maturation?

The enzymatic function of Lnt involves a multi-step mechanism for lipoprotein maturation. The process begins with the enzyme recognizing diacylated lipoprotein precursors and facilitating the transfer of a third acyl group to the N-terminal cysteine residue. This conversion from diacylated to triacylated forms is crucial for proper lipoprotein function.

The catalytic mechanism relies on a conserved cysteine residue that forms a thioester intermediate with the acyl donor (typically a phospholipid). This acyl group is subsequently transferred to the α-amino group of the lipoprotein's N-terminal cysteine, completing the triacylation process.

For experimental investigation of this function, researchers should:

  • Express the recombinant enzyme in a suitable system (often E. coli)

  • Purify it using appropriate detergents to maintain structure and function

  • Conduct in vitro assays with synthetic diacylated substrates and phospholipid donors

  • Monitor the formation of triacylated products using mass spectrometry or chromatographic techniques

What buffer conditions are optimal for maintaining Verminephrobacter eiseniae Lnt stability?

Based on the available literature, recombinant Verminephrobacter eiseniae Apolipoprotein N-acyltransferase (lnt) is typically stored in a Tris/PBS-based buffer containing 6% Trehalose before lyophilization. This buffer composition helps maintain protein stability and activity.

When designing experimental protocols, researchers should consider:

  • Using Tris or phosphate-based buffers (pH 7.2-7.5) as the core buffer system

  • Including trehalose (5-7%) as a cryoprotectant for freeze-thaw stability

  • Adding mild detergents at concentrations above their critical micelle concentration to maintain protein solubility

  • Incorporating reducing agents (such as DTT or β-mercaptoethanol) to protect the catalytic cysteine residue

  • Testing the addition of glycerol (10-20%) for long-term storage stability

The specific buffer optimization should be experimentally determined based on activity assays and thermal stability measurements for each preparation of the recombinant enzyme.

How does Verminephrobacter eiseniae Lnt contribute to bacterial symbiosis with earthworms?

Verminephrobacter eiseniae is a nephridial symbiont of earthworms (specifically Eisenia fetida), relying on motility factors like flagella and type IV pili for host colonization. The role of Lnt in this symbiotic relationship appears to be multifaceted, though still incompletely characterized.

To investigate this relationship methodologically:

  • Generate defined lnt knockout mutants: Use plasmid-based gene replacement strategies. The search results indicate that plasmids containing trfA and oriV from pVEIS01 (a related IncP-1 plasmid of V. eiseniae) are competent for replication in this organism . Include toxin-antitoxin systems like pemI/pemK for plasmid stability in the absence of selection .

  • Perform colonization assays: Compare the ability of wild-type and lnt-deficient V. eiseniae to colonize sterile earthworm nephridia. Quantify bacterial populations by microscopy or culture-based methods.

  • Analyze membrane integrity: Assess whether lnt mutation affects membrane properties that may be crucial for surviving host-derived stressors. Membrane permeability assays using fluorescent dyes can reveal structural defects.

  • Examine host immune responses: Investigate if triacylated lipoproteins produced by Lnt modulate Toll-like receptor signaling in the host, potentially influencing immune tolerance of the symbiont.

  • Study horizontal gene transfer: Explore how natural transformation, which has been demonstrated in V. eiseniae , might contribute to genetic variation in lnt and subsequent adaptation to the symbiotic lifestyle.

What experimental approaches can characterize the relationship between Lnt activity and antibiotic resistance?

The connection between Lnt activity and antibiotic resistance has been suggested by research showing that loss of Lnt activity in Acinetobacter increases membrane permeability and antibiotic sensitivity. This relationship can be methodologically investigated in V. eiseniae through:

  • Minimum inhibitory concentration (MIC) determination:

    • Generate lnt mutants with various degrees of functional impairment

    • Test a panel of antibiotics with different mechanisms of action

    • Compare MIC values between wild-type and mutant strains

    • Focus particularly on antibiotics targeting cell envelope or requiring membrane penetration

  • Membrane permeability assays:

    • Use fluorescent probes that only enter cells with compromised membranes

    • Quantify fluorescence intensity as a measure of membrane integrity

    • Correlate permeability changes with antibiotic susceptibility patterns

  • Lipidomic analysis:

    • Conduct comprehensive lipid profiling of wild-type and lnt-deficient membranes

    • Identify changes in membrane composition that might affect antibiotic penetration

    • Use mass spectrometry to characterize changes in lipoproteins and other membrane components

  • Transcriptomic response:

    • Analyze global gene expression changes in response to lnt mutation

    • Identify compensatory mechanisms or stress responses activated

    • Look specifically for changes in expression of known antibiotic resistance genes

This methodological approach provides a framework for dissecting the mechanistic link between Lnt function and antibiotic resistance in V. eiseniae.

How can structural biology approaches elucidate the catalytic mechanism of Verminephrobacter eiseniae Lnt?

Understanding the catalytic mechanism of V. eiseniae Lnt requires detailed structural characterization. Based on available information about the enzyme's active site and conformational flexibility, the following methodological approaches are recommended:

  • X-ray crystallography:

    • Optimize protein expression and purification to obtain homogeneous preparations

    • Screen crystallization conditions, considering membrane protein-specific approaches

    • Use lipidic cubic phase crystallization for membrane proteins

    • Obtain structures in multiple states (apo, substrate-bound, product-bound)

    • Focus on the dynamic loops that regulate substrate access, as identified in E. coli Lnt structures

  • Site-directed mutagenesis of catalytic residues:

    • Target the catalytic cysteine equivalent to Cys387 in E. coli Lnt

    • Create systematic mutations of surrounding residues to map the complete active site

    • Assess enzymatic activity of each mutant to correlate structure with function

    • Use kinetic analysis to determine which step of the reaction is affected by each mutation

  • Enzyme-substrate complex characterization:

    • Design substrate analogs that form stable intermediates with the catalytic cysteine

    • Use mass spectrometry to identify covalent enzyme-substrate adducts

    • Attempt crystallization of these trapped intermediates

    • Combine with molecular dynamics simulations to model the catalytic cycle

  • Comparative structural analysis:

    • Analyze structural differences between V. eiseniae Lnt and homologs from other bacteria

    • Identify conserved and variable regions that might relate to substrate specificity

    • Construct chimeric enzymes to test functional hypotheses derived from structural comparisons

What are the key considerations for expressing and purifying functional recombinant Verminephrobacter eiseniae Lnt?

The expression and purification of functional recombinant V. eiseniae Lnt requires careful optimization due to its nature as a membrane protein. A methodological approach should consider:

  • Expression system selection:

    • Choose specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Consider codon optimization of the lnt gene for the expression host

    • Design constructs with appropriate fusion tags (His-tag, MBP) to aid solubility and purification

    • Include TEV or PreScission protease sites for tag removal if needed

  • Induction and growth conditions:

    • Use lower temperatures (16-20°C) to promote proper folding

    • Implement gentle induction with reduced IPTG concentrations (0.1-0.5 mM)

    • Extend expression time (overnight to 24 hours) at lower temperatures

    • Consider auto-induction media for gradual protein expression

  • Membrane extraction and solubilization:

    • Carefully isolate membrane fractions through differential centrifugation

    • Test multiple detergents for optimal solubilization (DDM, CHAPS, LDAO)

    • Include glycerol (10-20%) to stabilize the protein during solubilization

    • Maintain reducing conditions to protect the catalytic cysteine

  • Purification strategy:

    • Use immobilized metal affinity chromatography (IMAC) as a first step

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography for further purification if needed

    • Verify enzyme activity at each purification step

  • Storage conditions:

    • Use the Tris/PBS-based buffer with 6% Trehalose mentioned in the literature

    • Consider flash-freezing aliquots in liquid nitrogen

    • Validate enzyme stability under storage conditions through activity assays

How can researchers investigate horizontal gene transfer of lnt in Verminephrobacter eiseniae?

The evidence that V. eiseniae mediates natural transformation provides an opportunity to study horizontal gene transfer of lnt. A methodological approach would include:

  • Natural transformation assays:

    • Develop protocols to measure transformation frequency in V. eiseniae

    • Prepare donor DNA containing lnt variants with selectable markers

    • Quantify transformation events under different environmental conditions

    • Analyze the integration patterns of acquired DNA

  • Comparative genomic analysis:

    • Obtain lnt sequences from various V. eiseniae isolates from different earthworm populations

    • Construct phylogenetic trees to identify potential horizontal gene transfer events

    • Calculate sequence divergence metrics (dN/dS ratios) to identify selection pressures

    • Compare gene synteny around the lnt locus across bacterial species

  • Experimental evolution studies:

    • Subject V. eiseniae populations to selective pressures relevant to lnt function

    • Monitor genetic changes in lnt over multiple generations

    • Sequence evolved populations to detect acquisition of novel lnt variants

    • Correlate genetic changes with phenotypic adaptations

  • Functional validation of transferred genes:

    • Express and characterize lnt variants acquired through horizontal transfer

    • Compare enzymatic properties with the original V. eiseniae Lnt

    • Assess whether acquired variants confer adaptive advantages

    • Test complementation of lnt mutants with horizontally acquired variants

This methodological framework leverages the natural transformation capability of V. eiseniae to understand the evolution and diversification of lnt genes in this symbiotic bacterium.

What methodological approaches can determine the role of Lnt in membrane integrity and stress responses?

Investigating how Lnt affects membrane integrity and stress responses requires a multi-faceted approach:

  • Generation of conditional lnt mutants:

    • Create strains with inducible expression of lnt to control enzyme levels

    • Develop point mutations affecting catalytic activity rather than protein stability

    • Use plasmid-based complementation with the pemI/pemK stability system

  • Membrane permeability assessment:

    • Employ fluorescent dyes (propidium iodide, SYTOX Green) to quantify permeability changes

    • Measure uptake of normally excluded compounds as indicators of membrane defects

    • Use fluorescence microscopy and flow cytometry for single-cell analysis of permeability

  • Lipidomic analysis under stress conditions:

    • Expose wild-type and lnt-deficient strains to relevant stressors (host-derived compounds, pH shifts)

    • Perform comprehensive lipidomic profiling using LC-MS/MS

    • Compare lipid compositions under normal and stress conditions

    • Identify compensatory changes in membrane composition

  • Transcriptomic and proteomic responses:

    • Conduct RNA-seq analysis to identify differentially expressed genes in lnt mutants

    • Focus on stress response pathways and membrane homeostasis mechanisms

    • Validate key findings with targeted protein expression analysis

    • Construct reporter fusions to monitor stress response activation in real-time

  • Host-relevant stress tolerance:

    • Test survival under conditions mimicking the earthworm nephridial environment

    • Assess resistance to antimicrobial peptides and other host defense molecules

    • Measure biofilm formation capacity as a stress response mechanism

    • Investigate cell envelope integrity under osmotic or oxidative stress

This methodological framework provides a comprehensive approach to understanding how Lnt contributes to membrane integrity and stress adaptation in V. eiseniae.

How does Verminephrobacter eiseniae Lnt differ from Lnt homologs in other bacterial species?

A comparative analysis of V. eiseniae Lnt with homologs from other bacteria can provide insights into species-specific adaptations and conserved mechanisms. The methodological approach should include:

  • Sequence alignment and phylogenetic analysis:

    • Collect Lnt sequences from diverse bacterial taxa

    • Perform multiple sequence alignments to identify conserved and variable regions

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Map known functional residues (e.g., the catalytic cysteine) onto the alignment

  • Structural comparison:

    • Use homology modeling to predict the structure of V. eiseniae Lnt based on E. coli Lnt crystal structures

    • Analyze conservation of active site architecture and substrate-binding regions

    • Identify structural differences that might relate to substrate specificity or environmental adaptation

    • Focus on the dynamic loops that regulate substrate access, as mentioned in the search results

  • Functional complementation studies:

    • Construct expression vectors containing lnt genes from various bacterial species

    • Test their ability to complement an lnt-deficient V. eiseniae strain

    • Analyze which homologs restore wild-type phenotypes and which fail

    • Correlate complementation ability with sequence/structural features

  • Biochemical characterization:

    • Express and purify Lnt from V. eiseniae and selected comparison species

    • Compare enzymatic parameters (Km, kcat, substrate preference)

    • Test activity under different conditions (pH, temperature, ionic strength)

    • Identify species-specific functional adaptations

This comparative approach can reveal how V. eiseniae Lnt has evolved in the context of its symbiotic lifestyle with earthworms compared to homologs from free-living or pathogenic bacteria.

What can plasmid replication elements from Verminephrobacter eiseniae teach us about genetic tools for manipulating Lnt expression?

The search results indicate that plasmids containing trfA and oriV from pVEIS01, a related IncP-1 plasmid of V. eiseniae, are competent for replication in this organism . This provides valuable information for developing genetic tools:

  • Shuttle vector development:

    • Design vectors incorporating the V. eiseniae trfA and oriV elements for replication

    • Include the pemI/pemK toxin-antitoxin system to improve plasmid stability in the absence of selection

    • Add appropriate selection markers and multiple cloning sites

    • Test replication efficiency in both V. eiseniae and E. coli

  • Expression control systems:

    • Develop inducible promoter systems compatible with V. eiseniae

    • Create lnt expression constructs with varying promoter strengths

    • Design systems for controlled depletion of Lnt to study its essential functions

    • Validate expression systems using reporter genes before applying to lnt

  • Gene replacement strategies:

    • Use plasmid-based approaches for targeted modification of the chromosomal lnt gene

    • Design constructs for allelic exchange to introduce specific mutations

    • Create conditional lnt mutants for studying essential functions

    • Implement CRISPR-Cas9 systems adapted for V. eiseniae

  • Dual-function elements:

    • Combine replication and stability elements into minimal functional units

    • Test compatibility with various expression cassettes

    • Optimize vector size to improve transformation efficiency

    • Develop standardized modular components for genetic manipulation

This methodological framework leverages the known plasmid biology of V. eiseniae to develop effective genetic tools for manipulating Lnt expression and studying its function in this symbiotic bacterium.

How might high-throughput approaches advance our understanding of Verminephrobacter eiseniae Lnt substrate specificity?

High-throughput methodologies can systematically explore Lnt substrate preferences and catalytic parameters:

  • Substrate library screening:

    • Generate libraries of synthetic diacylated lipoprotein substrates with variations in:

      • N-terminal amino acid sequence

      • Acyl chain composition of the diacylglycerol moiety

      • Protein size and structure

    • Develop a high-throughput assay to measure N-acylation efficiency

    • Identify substrate features that enhance or inhibit Lnt activity

  • Phospholipid donor screening:

    • Test diverse phospholipids as acyl donors with varying:

      • Head group chemistry

      • Acyl chain length and saturation

      • Membrane fluidity characteristics

    • Employ mass spectrometry to identify the transferred acyl groups

    • Correlate donor preferences with the natural phospholipid composition of V. eiseniae membranes

  • Deep mutational scanning:

    • Create comprehensive libraries of Lnt variants with single amino acid substitutions

    • Develop selection or screening systems to identify variants with altered activity

    • Map mutations affecting substrate specificity onto structural models

    • Use machine learning to predict specificity determinants from sequence-function relationships

  • Proteomics identification of natural substrates:

    • Compare the lipoprotein profiles of wild-type and lnt-deficient V. eiseniae

    • Identify proteins that show altered N-terminal acylation

    • Characterize common features of preferred substrates in vivo

    • Correlate substrate utilization with functional pathways

This methodological framework provides a systematic approach to understanding the substrate preferences of V. eiseniae Lnt, which could reveal adaptations specific to its symbiotic lifestyle.

What potential applications exist for recombinant Verminephrobacter eiseniae Lnt in synthetic biology?

Recombinant V. eiseniae Lnt could be leveraged for various synthetic biology applications:

  • Engineered membrane protein display systems:

    • Develop platforms using Lnt-mediated N-acylation for membrane anchoring

    • Create modular expression systems combining signal peptides, lipidation sites, and cargo proteins

    • Optimize surface display of functional proteins in bacterial systems

    • Apply to vaccine development, biocatalysis, and biosensor design

  • Cell-free lipoprotein synthesis:

    • Establish in vitro systems for producing triacylated lipoproteins

    • Combine recombinant Lnt with other lipoprotein processing enzymes

    • Control acylation patterns by providing defined phospholipid donors

    • Use for studying lipoprotein-receptor interactions without cellular complexity

  • Metabolic engineering applications:

    • Exploit Lnt to create membrane-anchored enzyme cascades

    • Enhance substrate channeling through spatial organization of reaction components

    • Improve stability of industrial enzymes through membrane association

    • Develop new approaches for whole-cell biocatalysis

  • Bionanotechnology platforms:

    • Create lipid nanoparticles with controlled protein display

    • Develop self-assembling systems using Lnt-processed lipoproteins

    • Design biomimetic interfaces for medical and materials applications

    • Engineer bacterial outer membrane vesicles with tailored surface properties

This methodological approach to synthetic biology applications leverages the unique properties of V. eiseniae Lnt, potentially leading to novel biotechnological tools and platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.