Recombinant Verminephrobacter eiseniae Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant V. eiseniae DsbB is a cloned version of the membrane-bound oxidoreductase from the symbiotic bacterium Verminephrobacter eiseniae (strain EF01-2), optimized for heterologous expression in Escherichia coli. It belongs to the DsbB family (UniProt ID: A1WG92) and is essential for transferring electrons from DsbA to membrane-embedded quinones, enabling disulfide bond formation in substrate proteins .

Molecular Mechanism

DsbB operates as a redox transducer:

  1. Oxidation of DsbA: DsbB reoxidizes DsbA via thiol-disulfide exchange or direct quinone reduction, depending on cysteine availability .

  2. Electron Transfer: Electrons from DsbA are shuttled to ubiquinone/menaquinone via DsbB’s periplasmic cysteine pairs (Cys41–Cys44 and Cys104–Cys130) .

  3. Controversial Pathways: Recent studies suggest DsbB may bypass traditional disulfide exchange, directly coupling quinone reduction to DsbA oxidation .

Expression Systems

  • Host: E. coli (BL21 or similar strains) .

  • Yield: Optimized via periplasmic targeting using Sec/SRP pathways .

Biotechnological Uses

  • Protein Folding Studies: Used to dissect disulfide bond formation mechanisms in Gram-negative bacteria .

  • Enzyme Engineering: Co-expressed with DsbA/DsbC to enhance folding of recombinant antibodies, hormones, and industrial enzymes .

  • ELISA Kits: Commercialized for research (e.g., Anagnostics’ 50 µg lyophilized product) .

Comparative Analysis with Other Oxidoreductases

FeatureDsbBVKOR Homologues
Electron AcceptorQuinonesVitamin K epoxide
OrganismsProteobacteria, V. eiseniaeActinobacteria, Cyanobacteria
Clinical RelevanceAntibiotic targetWarfarin target (e.g., human VKORC1)
Disulfide MechanismDirect quinone coupling Requires thioredoxin-like partners

Research Findings

  • Essentiality: V. eiseniae DsbB is critical for cytochrome c maturation and anaerobic respiration .

  • Mutational Studies: Cysteine-deficient DsbB mutants retain partial activity, suggesting alternative redox routes .

  • Biophysical Data: Redox potentials of DsbB’s disulfides (-271 mV and -284 mV) are less oxidizing than DsbA’s (-120 mV), challenging traditional models .

Future Directions

  • Structural Studies: Cryo-EM analysis of V. eiseniae DsbB-quinone complexes.

  • Industrial Applications: Optimizing DsbB-DsbA co-expression for high-yield production of disulfide-rich biologics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust accordingly.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; Veis_0870; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Verminephrobacter eiseniae (strain EF01-2)
Target Names
dsbB
Target Protein Sequence
MMVWNWIDRTPRRVLALISLACVALLACGLYLQHVVGLVPCPMCIVQRYALIGLALLTGL ASARSAKGWWLTLSALAALTAGFGATVAARQSWLQWYPPQSVSCGRDFYGMIESFPLSRA IPMILRGSGDCAAVDWSLLGGSIANWSFLCFALLGLLLLALLARGVRGARQRAPAPV
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Verminephrobacter eiseniae and why is it significant for DsbB research?

Verminephrobacter eiseniae is an obligate bacterial symbiont of the earthworm Eisenia fetida. It belongs to a microbial consortium that colonizes embryonic worms after being transmitted into egg capsules . This bacterium is particularly interesting for DsbB research because it represents an opportunity to study disulfide bond formation pathways in symbiotic bacteria, potentially revealing adaptations specific to its earthworm host environment. V. eiseniae has maintained a relatively large, intact genome despite being a long-associated obligate symbiont, which may be related to its ability to take up species-specific DNA from the environment .

What is the fundamental function of DsbB in bacterial systems?

DsbB is a membrane protein with four transmembrane segments and two periplasmic loops, each containing one pair of conserved cysteine residues that are maintained in an oxidized state . Its primary function is to recycle the periplasmic oxidoreductase DsbA back to its oxidized form after DsbA has introduced disulfide bonds into substrate proteins . DsbB channels electrons away from DsbA and delivers them to bound quinone molecules, generating disulfides de novo with concomitant quinone reduction . This process connects oxidative protein folding to the electron transport chain, with molecular oxygen being the terminal electron acceptor under aerobic conditions .

How does the DsbA-DsbB pathway operate in bacteria?

The reaction between DsbA and DsbB is initiated by the nucleophilic attack of the first cysteine residue of DsbA's CXXC motif on the oxidized cysteines of the second periplasmic loop of DsbB (pair 2) . This leads to the formation of a DsbA-DsbB mixed-disulfide complex . The mixed disulfide is then transferred to DsbA, releasing the cysteine residues of pair 2 of DsbB in the reduced form . Reoxidation of these cysteines occurs through electron transfer to the cysteines of pair 1, which are finally recycled back to the oxidized state by transferring electrons to an ubiquinone molecule under aerobic conditions or menaquinone under anaerobic conditions .

How should researchers design experiments to express and purify recombinant V. eiseniae DsbB?

For successful expression and purification of recombinant V. eiseniae DsbB, researchers should implement the following experimental design:

  • Vector Selection: Choose an expression vector with an inducible promoter (e.g., T7) and appropriate fusion tags for detection and purification.

  • Expression System: Select a bacterial expression system optimized for membrane proteins, considering E. coli strains like C41(DE3) or C43(DE3) that are specifically designed for toxic membrane proteins.

  • Induction Conditions: Test multiple conditions including:

    • Temperature (18°C, 25°C, 30°C, 37°C)

    • Inducer concentration (0.1-1.0 mM IPTG)

    • Duration of induction (3h, 6h, overnight)

  • Membrane Extraction: Implement a two-phase extraction process using:

    • Initial cell lysis (sonication or French press)

    • Membrane fraction isolation through ultracentrifugation

  • Solubilization: Test multiple detergents for optimal solubilization:

DetergentConcentration RangeAdvantagesDisadvantages
DDM0.5-2%Good for preserving activityRelatively expensive
LDAO0.5-2%Efficient solubilizationMay affect activity
Triton X-1000.5-2%Cost-effectiveLarge micelle size
Digitonin0.5-2%Mild, maintains structureVery expensive
  • Purification Strategy: Implement a multi-step purification process using:

    • IMAC (for His-tagged proteins)

    • Size exclusion chromatography

    • Optional ion exchange chromatography

Each experimental condition should be assessed for protein yield, purity, and importantly, functional activity using specific DsbB assays.

What techniques can verify the structural integrity and function of recombinant V. eiseniae DsbB?

Researchers can employ multiple complementary techniques to verify both structural integrity and function:

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to assess proper folding

    • Size exclusion chromatography to evaluate oligomeric state

  • Functional Assays:

    • DsbA Oxidation Assay: Monitor the ability of DsbB to oxidize reduced DsbA using fluorescence-based assays that detect the formation of disulfide bonds

    • Quinone Reduction Assay: Measure spectrophotometric changes as DsbB transfers electrons to quinones

    • Oxygen Consumption: In reconstituted systems, measure oxygen consumption as the terminal step in the electron transfer chain

  • Complementation Studies:

    • Express V. eiseniae DsbB in E. coli dsbB-null mutants to test functional complementation

    • Measure restoration of disulfide-dependent phenotypes (e.g., motility, alkaline phosphatase activity)

How can researchers design controlled experiments to study V. eiseniae DsbB's role in bacterial-host symbiosis?

To investigate the role of DsbB in V. eiseniae's symbiotic relationship with earthworms, researchers should design experiments that specifically examine the impact of DsbB on symbiosis-related functions:

  • Genetic Approach:

    • Generate dsbB knockout mutants using natural transformation, as V. eiseniae has been shown to be naturally competent

    • Create point mutations in the conserved cysteine residues to disrupt function without completely removing the protein

  • Colonization Studies:

    • Compare colonization efficiency of wild-type vs. dsbB mutant strains in earthworm egg capsules

    • Track bacterial populations over time using fluorescent tagging or qPCR quantification

  • Protein Expression Analysis:

    • Perform comparative proteomics between wild-type and dsbB mutant strains to identify proteins whose proper folding depends on DsbB

    • Focus on secreted and membrane proteins likely involved in host interaction

  • Experimental Design Controls:

    • Include complemented strains (dsbB mutants with restored dsbB expression) to verify phenotypes are specifically due to dsbB loss

    • Use E. coli dsbB as a heterologous control to test functional conservation

  • Environmental Variable Testing:

    • Test symbiotic function under varying oxygen concentrations to assess the role of aerobic vs. anaerobic DsbB function

    • Examine pH dependency of DsbB function relevant to earthworm gut conditions

How might the structure and function of V. eiseniae DsbB differ from the well-characterized E. coli DsbB?

While the core structure of DsbB is likely conserved between species, several key differences may exist that reflect adaptation to the symbiotic lifestyle of V. eiseniae:

FeatureE. coli DsbBPredicted V. eiseniae DsbBFunctional Implication
Transmembrane segments4 segmentsLikely 4 segments with possible sequence variationsMay affect membrane positioning or quinone interactions
Periplasmic loops2 loops with conserved cysteine pairsLikely 2 loops with possible length or sequence variationsMay influence interaction with symbiosis-specific substrates
Quinone preferenceUbiquinone (aerobic), Menaquinone (anaerobic) Unknown, but potentially adapted to microaerobic conditions in earthworm environmentMay reflect adaptation to fluctuating oxygen levels in host
Redox potentialHighly oxidizingPotentially modified redox potentialMay be tuned to specific substrates important for symbiosis
Substrate rangeBroad range of periplasmic proteinsPotentially specialized for symbiosis-related proteinsMay reflect specialization for symbiotic lifestyle

The structural and functional differences would best be determined through comparative biochemical studies and structural analyses of both proteins.

What experimental approaches can resolve contradictory data in V. eiseniae DsbB research?

When researchers encounter contradictory data regarding V. eiseniae DsbB function or structure, the following approaches can help resolve discrepancies:

  • Standardization of Experimental Conditions:

    • Implement a systematic experimental design protocol that controls variables including:

      • Expression systems and conditions

      • Purification methods and detergent selection

      • Buffer compositions and pH

      • Temperature and oxidation state during assays

  • Multiple Methodological Approaches:

    • Apply orthogonal techniques to verify the same parameter

    • For activity measurements, use both:

      • Direct assays (quinone reduction)

      • Indirect assays (DsbA oxidation)

      • In vivo complementation studies

  • Genetic Validation:

    • Create genetic variants with specific mutations targeting functional domains

    • Test predictions about structure-function relationships with point mutations in conserved residues

  • Collaborative Cross-Validation:

    • Distribute identical protein preparations to multiple labs for independent verification

    • Establish standard reference materials and protocols

  • Environmental Context Consideration:

    • Test function under varied conditions that mimic the natural environment:

      • Oxygen tension

      • pH ranges

      • Temperature variations

      • Presence of earthworm-derived compounds

How do mutations in conserved cysteine residues of V. eiseniae DsbB impact its function in disulfide bond formation?

Mutations in the conserved cysteine residues of DsbB would have profound effects on its function, which can be experimentally characterized:

MutationPredicted Effect on StructurePredicted Effect on FunctionExperimental Approach to Verify
C41S (Pair 1, first cysteine)Minimal structural changeInability to transfer electrons to quinonesQuinone reduction assay, UV-visible spectroscopy
C44S (Pair 1, second cysteine)Minimal structural changeDisrupted electron flow within DsbBDisulfide exchange kinetics measurement
C104S (Pair 2, first cysteine)Minimal structural changeInability to form mixed disulfide with DsbAMass spectrometry to identify mixed disulfides
C130S (Pair 2, second cysteine)Minimal structural changeDisrupted resolution of DsbA-DsbB complexTrapping and characterization of reaction intermediates
Double mutations (C41S/C44S)Potential loop destabilizationComplete loss of quinone interactionBinding assays with fluorescent quinone analogs
Double mutations (C104S/C130S)Potential loop destabilizationComplete loss of DsbA oxidation capabilityIn vivo complementation assays in E. coli dsbB-null strain

These mutations provide valuable tools for understanding the catalytic mechanism of DsbB and can help identify potential differences between V. eiseniae and other bacterial species.

What are the most effective methods for overcoming protein aggregation during recombinant V. eiseniae DsbB expression?

Protein aggregation is a significant challenge when expressing membrane proteins like DsbB. Researchers can implement the following strategies:

  • Expression Optimization:

    • Reduce expression temperature to 16-20°C to slow protein synthesis and allow proper folding

    • Decrease inducer concentration to reduce expression rate

    • Use specialized E. coli strains that co-express chaperones

  • Fusion Partners:

    • Employ solubility-enhancing fusion partners such as:

      • Maltose-binding protein (MBP)

      • Small ubiquitin-like modifier (SUMO)

      • Thioredoxin (Trx)

  • Detergent Screening:

    • Systematically test detergents for membrane extraction using a clear decision tree:

      • Start with mild detergents (DDM, LMNG)

      • If yield is insufficient, move to more powerful detergents (LDAO, FC-12)

      • Balance extraction efficiency with protein stability

  • Co-expression Strategies:

    • Co-express with interaction partners (e.g., DsbA) to stabilize the native conformation

    • Co-express with specific chaperones known to assist membrane protein folding

  • Buffer Optimization:

    • Screen additive compounds that enhance stability:

      • Glycerol (10-20%)

      • Specific lipids (E. coli polar lipids, cardiolipin)

      • Stabilizing salts (300-500 mM NaCl)

How can researchers accurately measure the redox activity of V. eiseniae DsbB in vitro?

Accurate measurement of DsbB redox activity requires carefully designed assays:

  • DsbA Oxidation Assay:

    • Prepare reduced DsbA with precisely controlled redox state

    • Monitor oxidation kinetics using:

      • Intrinsic tryptophan fluorescence changes

      • Thiol-reactive fluorescent probes

      • Alkylation followed by mass spectrometry

  • Quinone Reduction Assay:

    • Use defined quinone substrates (ubiquinone-1 or ubiquinone-5)

    • Monitor spectrophotometric changes at specific wavelengths:

      • Ubiquinone: 275 nm

      • Menaquinone: 270 nm

    • Calculate initial rates across multiple substrate concentrations for kinetic analysis

  • Oxygen Consumption Measurement:

    • Employ oxygen electrode systems (Clark-type)

    • Reconstruct complete electron transfer pathway with purified components

    • Calibrate system with known standards

  • Control Experiments:

    • Include inactive DsbB variants (cysteine mutants) as negative controls

    • Perform assays under anaerobic conditions to distinguish quinone-dependent activity

    • Include appropriate no-enzyme controls

  • Data Analysis:

    • Apply enzyme kinetics models to determine:

      • kcat and KM for different substrates

      • Effects of pH, temperature, and ionic strength

      • Inhibition patterns by specific compounds

What experimental designs can elucidate the interactions between V. eiseniae DsbB and its native redox partners?

To characterize interactions between V. eiseniae DsbB and its redox partners, researchers should implement these experimental approaches:

  • Co-purification Studies:

    • Perform tandem affinity purification using tagged DsbB

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions using reciprocal pull-downs

  • Binding Affinity Measurements:

    • Use surface plasmon resonance (SPR) to determine:

      • Association and dissociation rate constants

      • Equilibrium dissociation constants

      • Effects of mutations on binding

  • Cross-linking Studies:

    • Apply chemical cross-linkers with varying spacer lengths

    • Identify cross-linked residues by mass spectrometry

    • Map interaction interfaces based on cross-linking patterns

  • Microscale Thermophoresis:

    • Measure binding in solution with minimal protein consumption

    • Determine binding affinities under near-native conditions

    • Evaluate effects of detergents and lipids on interactions

  • Functional Reconstitution:

    • Reconstitute the complete electron transfer pathway in proteoliposomes

    • Measure activity with different combinations of components

    • Assess the effects of lipid composition on activity and interactions

TechniqueInformation ProvidedAdvantagesLimitations
SPRBinding kinetics and affinityReal-time, label-freeRequires surface immobilization
ITCThermodynamic parametersSolution-based, label-freeHigh protein consumption
MSTBinding in near-native conditionsLow sample consumptionRequires fluorescent labeling
Cross-linking + MSInteraction interfacesCaptures transient interactionsPotential artifacts from cross-linking
HDX-MSConformational changes upon bindingMaps interaction regionsComplex data analysis

How might high-throughput screening approaches identify inhibitors or modulators of V. eiseniae DsbB?

Researchers can implement the following high-throughput screening (HTS) approaches to identify compounds that modulate V. eiseniae DsbB activity:

  • Fluorescence-based Primary Screens:

    • Develop assays based on DsbA oxidation using thiol-reactive fluorescent probes

    • Implement in 384-well format for screening compound libraries

    • Include controls for distinguishing specific DsbB inhibition from general redox effects

  • Secondary Validation Assays:

    • Confirm hits using orthogonal assays:

      • Quinone reduction measured spectrophotometrically

      • Oxygen consumption assays

      • In vivo complementation tests

  • Structure-Activity Relationship Studies:

    • Group effective compounds by chemical scaffolds

    • Synthesize analogs to improve potency and selectivity

    • Use computational modeling to predict binding modes

  • Target Validation:

    • Employ thermal shift assays to confirm direct binding

    • Use site-directed mutagenesis to identify binding sites

    • Perform competition assays with known DsbB substrates

  • Selectivity Profiling:

    • Test activity against DsbB from multiple bacterial species

    • Assess effects on mammalian disulfide bond formation enzymes

    • Evaluate general cytotoxicity in bacterial and mammalian cells

What role might V. eiseniae DsbB play in bacterial adaptation to the earthworm microenvironment?

V. eiseniae DsbB likely plays a crucial role in adaptation to the earthworm microenvironment through ensuring proper folding of proteins involved in symbiosis:

  • Adaptation to Microaerobic Conditions:

    • DsbB may show specialized adaptations for functioning under the varying oxygen levels in earthworm tissues

    • The quinone specificity may be tailored to the redox conditions of the earthworm environment

  • Symbiosis-Specific Protein Folding:

    • DsbB likely ensures proper folding of secreted and membrane proteins involved in:

      • Adhesion to earthworm tissues

      • Communication with host cells

      • Resistance to host defense mechanisms

      • Nutrient acquisition within the host

  • Experimental Approaches to Investigate:

    • Comparative genomics of DsbB across free-living and symbiotic bacteria

    • Identification of DsbB-dependent proteins through proteomics

    • Analysis of DsbB expression patterns during different stages of symbiosis

    • Creation of conditional DsbB mutants to study the timing of requirement

  • Potential Model for Bacterial-Host Coevolution:

    • Study of V. eiseniae DsbB may provide insights into how oxidative protein folding systems adapt during the evolution of symbiotic relationships

    • The natural transformation capacity of V. eiseniae may allow for genetic exchange that influences DsbB function in the symbiotic context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.