Recombinant Verminephrobacter eiseniae NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate your preferred format in your order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipment, please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Veis_2813; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Verminephrobacter eiseniae (strain EF01-2)
Target Names
nuoA
Target Protein Sequence
MNLDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVR YYLVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE
Uniprot No.

Target Background

Function

NDH-1 transfers electrons from NADH, via FMN and iron-sulfur (Fe-S) clusters, to quinones within the respiratory chain. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant V. eiseniae nuoA?

E. coli expression systems have proven most effective for producing recombinant V. eiseniae nuoA, with several considerations for optimization:

Recommended expression systems:

  • BL21(DE3) strain with pET vector systems (particularly pET21b)

  • T7 promoter-based expression for high-level production

  • C-terminal His-tag configuration for improved stability and purification

Based on similar recombinant protein studies, expression parameters should be optimized using response surface methodology, which systematically evaluates:

ParameterOptimal RangeNotes
IPTG concentration0.1-0.5 mMHigher concentrations may cause inclusion body formation
Post-induction time4-6 hoursLonger times risk protein degradation
Cell density (OD₆₀₀)0.6-0.8For initial induction
Temperature25-28°CLower than standard 37°C improves folding

Codon optimization for E. coli is recommended, as V. eiseniae has a high GC content (65.3%) that may affect expression efficiency in heterologous systems .

What purification strategies work best for isolating recombinant V. eiseniae nuoA?

Purification of recombinant V. eiseniae nuoA requires specialized protocols due to its membrane-associated nature. A methodological approach includes:

  • Membrane fraction isolation:

    • Cell lysis using French press or sonication in buffer containing 50 mM Tris (pH 8.0), 300 mM NaCl, 10% glycerol

    • Differential centrifugation (10,000×g followed by 100,000×g)

    • Membrane solubilization using 1-2% mild detergent (DDM or LDAO)

  • Affinity chromatography:

    • IMAC purification using Ni-NTA resin for His-tagged protein

    • Washing with increasing imidazole concentrations (10-40 mM)

    • Elution with 250 mM imidazole

  • Further purification:

    • Size exclusion chromatography using Superdex 200

    • Ion exchange chromatography if higher purity is required

  • Storage optimization:

    • Buffer containing 50 mM Tris (pH 8.0), 150 mM NaCl, 10% glycerol, 0.03% DDM

    • Flash-freezing in liquid nitrogen and storage at -80°C

For long-term storage, lyophilization with 6% trehalose as a stabilizing agent has been shown to maintain protein integrity .

How can I verify the functional activity of recombinant V. eiseniae nuoA?

Verification of recombinant V. eiseniae nuoA functional activity requires both structural and enzymatic assessments:

Structural verification methods:

  • SDS-PAGE and Western blotting using anti-His antibodies

  • Circular dichroism to assess secondary structure integrity

  • Thermal shift assays to evaluate protein stability

Functional activity assays:

  • NADH oxidation assay: Monitor decrease in absorbance at 340 nm using the following reaction mixture:

    ComponentConcentration
    Potassium phosphate buffer (pH 7.5)50 mM
    NADH200 μM
    Ubiquinone-1100 μM
    Purified nuoA (part of Complex I)5-10 μg
  • Electron transfer assay: Using artificial electron acceptors like ferricyanide or dichlorophenolindophenol

  • Reconstitution experiments: Incorporation into proteoliposomes to measure proton pumping activity

Note that full Complex I activity assessment may require reconstitution with other subunits, as nuoA alone represents only one component of the multisubunit complex.

How does V. eiseniae nuoA differ from nuoA in free-living Acidovorax relatives?

V. eiseniae nuoA exhibits several distinct characteristics compared to its counterparts in free-living Acidovorax relatives, reflecting its symbiotic lifestyle:

Sequence and structural differences:

  • V. eiseniae nuoA maintains higher conservation of functional domains despite accelerated evolutionary rates in other parts of the genome

  • Codon usage bias is lower in V. eiseniae nuoA compared to Acidovorax homologs, consistent with genetic drift effects observed in symbiotic bacteria

Evolutionary comparison:
Despite long-term vertical transmission (62-136 million years) in the earthworm symbiosis, V. eiseniae nuoA shows:

  • Maintained functional integrity without pseudogenization

  • No significant AT bias, unlike many obligate intracellular symbionts

  • Strong purifying selection on respiratory chain components

This pattern contrasts with typical genome erosion seen in other ancient symbionts and may be explained by:

  • The extracellular nature of the symbiosis (V. eiseniae colonizes nephridia, not host cells)

  • Opportunity for genetic exchange through natural transformation

  • Selection pressure to maintain energy production efficiency in the symbiotic relationship

The ability of V. eiseniae to undergo natural transformation likely contributes to genetic conservation of essential genes like nuoA despite genetic drift acting on the genome as a whole .

What techniques can be used to study nuoA expression in V. eiseniae within earthworm nephridia?

Studying nuoA expression in V. eiseniae within earthworm nephridia requires specialized techniques:

Sample preparation approaches:

  • Nephridia isolation through microdissection from Eisenia fetida/foetida earthworms

  • Fixation with paraformaldehyde (PFA) for in situ techniques

  • Flash freezing in liquid nitrogen for RNA/protein extraction

Gene expression analysis methods:

  • RT-qPCR analysis:

    • RNA extraction using TRIzol from isolated nephridia

    • cDNA synthesis with random hexamers

    • qPCR targeting nuoA using primers designed from the V. eiseniae genome

    • Relative quantification against housekeeping genes (16S rRNA, rpoB)

  • Fluorescence in situ hybridization (FISH):

    • Hybridization at 35% formamide for 2.5 hours directly on fixed nephridia pieces

    • Use of specific fluorescent probes (similar to LSB145-CY5 which targets Verminephrobacter)

    • Counterstaining with DAPI and mounting in Vectashield/Citifluor mixture

    • Visualization using epifluorescence microscopy with Apotome for optical sectioning

  • Immunohistochemistry:

    • Generation of antibodies against recombinant nuoA

    • Tissue permeabilization and blocking steps

    • Fluorescent secondary antibody detection

Functional metabolic analysis:

  • Micro-respirometry of isolated nephridia

  • Inhibitor studies using Complex I-specific inhibitors

  • Comparative analysis of wild-type versus experimentally manipulated earthworms

These techniques can be combined with transmission electron microscopy to correlate nuoA expression with ultrastructural features of the symbiont within nephridia .

What site-directed mutagenesis strategies are most effective for studying functional domains in V. eiseniae nuoA?

For studying functional domains in V. eiseniae nuoA, several site-directed mutagenesis strategies have proven effective:

Recommended mutagenesis approaches:

  • Plasmid-based systems for V. eiseniae:

    • Creation of suicide vectors with homologous flanking regions (1 kb up/downstream), similar to approaches used for pilT mutagenesis

    • Use of pENTR/D-Topo-MCS vector systems for marker insertion between homologous regions

    • Natural transformation-based introduction of mutations, as V. eiseniae demonstrates high transformability

  • Key residues for targeted mutagenesis:

    • Conserved charged residues within transmembrane domains

    • Predicted quinone-binding residues

    • Putative proton translocation pathway components

  • Mutant screening strategy:

    • PCR verification of correct insertion

    • Expression analysis by RT-qPCR

    • Phenotypic characterization through growth rate analysis

Alternative approaches:

  • CRISPR/Cas9 approach modified for V. eiseniae:

    • Design of sgRNAs targeting nuoA

    • Introduction of homology-directed repair templates

    • Screening for successful editing events

For functional complementation studies, reintroduction of mutated nuoA variants can be accomplished through natural transformation, which has been demonstrated to occur at high frequency in V. eiseniae (up to 10⁻³ transformants per viable cell) .

How does the symbiotic lifestyle of V. eiseniae affect nuoA evolution compared to free-living bacteria?

The symbiotic lifestyle of V. eiseniae has produced a unique evolutionary trajectory for nuoA compared to free-living bacteria:

Evolutionary signatures in V. eiseniae nuoA:

  • Purifying selection pressure:

    • Strong purifying selection on respiratory chain components including nuoA

    • dN/dS ratios indicate significant constraints on amino acid changes despite genetic drift affecting other genome regions

  • Absence of typical symbiont genome erosion:

    • Unlike many obligate symbionts, V. eiseniae has maintained a large genome (5.6 Mb) with high GC content (65.3%)

    • No evidence of pseudogenization in nuoA despite 62-136 million years of symbiosis

    • Retention of functional integrity in energy production genes

  • Comparative genomic evidence:
    The table below compares evolutionary characteristics between V. eiseniae and free-living relatives:

    CharacteristicV. eiseniaeFree-living Acidovorax
    Genome size5.6 MbSimilar (no reduction)
    GC content65.3%Similar (no AT bias)
    Evolutionary rateAcceleratedSlower
    Genome rearrangementsExtensiveLess frequent
    Mobile genetic elementsAbundantFewer
    Codon usage biasLowerHigher
  • Influence of natural transformation:

    • Ability to take up and incorporate environmental DNA allows genetic refreshment

    • This mechanism may explain maintenance of genome integrity despite vertical transmission

    • DNA uptake within earthworm egg capsules provides opportunity for genetic exchange during symbiont transmission

The evolutionary trajectory of nuoA reflects a balance between genetic drift (due to population bottlenecks during vertical transmission) and purifying selection (maintaining essential metabolic functions), with natural transformation potentially mitigating the effects of drift-induced genome erosion .

What approaches can be used to study interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex in V. eiseniae?

Studying interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex in V. eiseniae requires specialized techniques for membrane protein complexes:

Protein-protein interaction methods:

  • Co-immunoprecipitation (Co-IP):

    • Generation of antibodies against nuoA or epitope-tagged versions

    • Gentle solubilization of membrane fractions with mild detergents (DDM, digitonin)

    • Identification of interacting partners by mass spectrometry

  • Crosslinking coupled with mass spectrometry:

    • Chemical crosslinking of intact membrane fractions

    • Digestion and MS/MS analysis to identify crosslinked peptides

    • Mapping of interaction interfaces between subunits

  • Blue Native PAGE:

    • Separation of intact respiratory complexes under native conditions

    • Western blotting with subunit-specific antibodies

    • In-gel activity assays using NADH and NBT/INT as electron acceptors

Structural biology approaches:

Functional interaction studies:

  • Site-directed mutagenesis of interface residues:

    • Targeted mutations at predicted interaction sites

    • Activity assays to assess functional consequences

    • Complementation studies in V. eiseniae

  • Reconstitution experiments:

    • Sequential addition of purified subunits to assess assembly

    • Activity measurements to correlate assembly with function

    • Proteoliposome incorporation to measure proton pumping

These approaches would provide insights into how the nuoA subunit contributes to the structure and function of Complex I in this unique symbiotic bacterium.

How can researchers investigate the role of nuoA in the earthworm-Verminephrobacter symbiosis?

Investigating the role of nuoA in the earthworm-Verminephrobacter symbiosis requires integrative approaches combining molecular genetics, biochemistry, and host-microbe interaction studies:

Genetic manipulation strategies:

  • Generation of nuoA mutants:

    • Site-directed mutagenesis using established techniques for V. eiseniae

    • Introduction of mutations through natural transformation

    • Creation of conditional knockdown strains if complete deletion is lethal

Physiological assessment methods:

  • In vivo functional studies:

    • Measurement of respiratory activity in isolated nephridia

    • Metabolomic profiling of nephridial contents

    • Comparative analysis between earthworms colonized with wild-type versus mutant V. eiseniae

  • Host response evaluation:

    • Transcriptomic analysis of earthworm nephridial tissue

    • Assessment of host reproduction and development

    • Measurement of nephridial filtration efficiency

Experimental design table for colonization studies:

Experimental GroupTreatmentMeasurementsTimeline
ControlWild-type V. eiseniaeColonization rate, bacterial density, host fitness1-6 weeks post-inoculation
Test 1nuoA point mutant (partial function)Same as controlSame as control
Test 2nuoA deletion mutantSame as controlSame as control
Test 3Complemented nuoA mutantSame as controlSame as control

Integration with symbiosis research:

  • Comparative analysis with other Verminephrobacter species and their earthworm hosts

  • Investigation of potential metabolic coupling between nuoA-dependent energy production and host physiology

  • Examination of nuoA expression under different environmental conditions and host states

These approaches would help elucidate whether nuoA and respiratory chain function are critical for establishing and maintaining the ancient earthworm-Verminephrobacter symbiosis, which has persisted for 62-136 million years .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.