Recombinant Verminephrobacter eiseniae Probable intracellular septation protein A (Veis_1802)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via bacterial expression systems, with optimized protocols for stability and solubility:

StepDetails
Expression SystemE. coli (His-tagged for affinity chromatography)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 5–50% glycerol for long-term storage
FormLyophilized powder or liquid (with 50% glycerol)

Research Applications

Veis_1802 is primarily utilized in:

  • Immunoassays: ELISA kits detect antibodies against this protein, suggesting its role as an antigen in symbiosis studies .

  • Structural Biology: His-tagged versions enable crystallization or NMR studies to elucidate membrane interaction mechanisms.

  • Host-Symbiont Interactions: The protein’s sequence hints at membrane localization, potentially linked to bacterial colonization or cell division .

Functional Insights and Knowledge Gaps

While the protein is annotated as a “probable intracellular septation protein,” its exact role remains unclear. Key observations include:

  • Membrane Association: Predicted transmembrane domains suggest involvement in cell division or membrane remodeling .

  • Symbiotic Context: V. eiseniae is vertically transmitted in earthworms, but Veis_1802’s role in this process is unexplored .

  • Genomic Rearrangements: V. eiseniae genomes exhibit high mobility (e.g., palindromic repeats), which may influence Veis_1802’s evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
yciB; Veis_1802; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Verminephrobacter eiseniae (strain EF01-2)
Target Names
Veis_1802
Target Protein Sequence
MKILLDFLPIVLFFGSYKLYGIYVATAVLMAATALQMALIYAIDRRLQTMHKVTLALILS FGALTLALQDDRFIKWKPTVLYGAMSVALALTLWALKKNFLKLLLGSQLALPDMVWLRLN WAWIAYCAFMSAINAYVVLHWSTDAWVDFKLWGYVFPLVFLIGQGLYIAPHLKNQGRT
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.

Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant Veis_1802?

For optimal stability and activity of recombinant Veis_1802, specific storage and handling conditions must be maintained. The protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Recommended storage and handling protocols include:

  • Storage buffer composition: Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

  • Long-term storage: -20°C/-80°C with 50% glycerol as the recommended final concentration

  • Reconstitution procedure: Briefly centrifuge vials before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Working conditions: Aliquot reconstituted protein and store working samples at 4°C for up to one week

  • Stability considerations: Repeated freeze-thaw cycles should be avoided to maintain protein integrity

These handling protocols are essential for maintaining the structural and functional integrity of the protein during experimental procedures. Deviations from these conditions may lead to protein degradation, aggregation, or loss of activity, potentially compromising experimental results.

How does Veis_1802 relate to bacterial symbiosis in earthworms?

Veis_1802 exists within the context of a highly specialized symbiotic relationship between Verminephrobacter eiseniae and its earthworm host Eisenia fetida. V. eiseniae colonizes the nephridia (excretory organs) of the earthworm, where bacterial cells bind and persist in a stable symbiotic relationship . The colonization process involves vertical transmission, where E. fetida transfers V. eiseniae into egg capsule albumin during capsule formation, followed by migration of bacterial cells into the developing embryonic worms' nephridia .

While the specific role of Veis_1802 in this symbiosis has not been directly established in the available research, its classification as an intracellular septation protein suggests potential involvement in bacterial cell division during colonization and persistence in the host. The protein may contribute to the proper cellular development and maintenance of V. eiseniae populations within the nephridial environment.

Research has demonstrated that V. eiseniae motility mechanisms, including both flagella and type IV pili, are essential for successful colonization of earthworm nephridia . Mutations in genes associated with these motility structures result in colonization deficiencies. As an inner membrane protein, Veis_1802 may interact with these motility systems or contribute to cellular processes that support symbiont establishment in the host environment.

What expression systems are most effective for producing recombinant Veis_1802?

The production of high-quality recombinant Veis_1802 requires careful selection of expression systems and optimization of expression conditions. Based on current methodologies, the following approach has proven effective:

  • Expression host: E. coli has been successfully used for heterologous expression of Veis_1802, with the recombinant protein fused to an N-terminal His tag . Specific E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21) may further improve yields.

  • Vector design: Vectors containing strong inducible promoters (T7, tac) with appropriate affinity tags for purification are recommended. The His-tag fusion approach has been validated for Veis_1802, facilitating purification via nickel affinity chromatography .

  • Expression conditions: For membrane proteins like Veis_1802, lower induction temperatures (16-20°C) and reduced inducer concentrations often improve proper folding and membrane integration, minimizing inclusion body formation.

  • Solubilization strategies: Due to its membrane-spanning nature, solubilization using mild detergents is typically required. A panel of detergents should be screened for optimal extraction efficiency while maintaining protein structure and function.

  • Purification workflow: A multi-step purification process involving immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography is recommended to achieve high purity.

This expression methodology typically yields protein with greater than 90% purity , suitable for subsequent functional and structural studies. The choice of expression system should be aligned with the intended experimental applications, with considerations for protein folding, post-translational modifications, and functional requirements.

How can researchers design effective mutational studies for Veis_1802?

Mutational analysis of Veis_1802 provides critical insights into structure-function relationships. A systematic approach to mutational studies should include:

  • Target identification strategy:

    • Sequence conservation analysis: Identify residues conserved across homologous proteins

    • Topology prediction: Target residues in predicted functional domains

    • Structure-based approach: If structural data is available, focus on active sites or interaction interfaces

  • Mutagenesis methodology:

    • Site-directed mutagenesis: For precise modification of specific residues

    • Domain deletion/swapping: To evaluate the function of larger protein segments

    • Alanine scanning: Systematic replacement of residues with alanine to neutralize side chain contributions

  • Functional assay development:

    • Growth/viability studies in V. eiseniae

    • Complementation assays in mutant strains

    • Cellular localization using fluorescent protein fusions

    • Protein-protein interaction studies using bacterial two-hybrid systems

  • In vivo relevance testing:

    • Colonization competence analysis using the established earthworm model system

    • Competition experiments between wild-type and mutant strains

    • Microscopic analysis of bacterial localization in nephridia

To establish a robust mutant testing system, researchers have developed methods for site-directed mutagenesis in V. eiseniae. These methods typically involve introducing the mutated gene into donor E. coli strains, followed by conjugation with recipient V. eiseniae strains . Successful transformants can be selected using appropriate antibiotics (e.g., kanamycin at 30 μg/ml and rifampicin at 100 μg/ml) .

What approaches are suitable for studying Veis_1802 in the context of natural transformation?

V. eiseniae possesses natural transformation capabilities, allowing it to incorporate free DNA from the environment . This process requires type IV pili and is regulated by environmental factors . To study Veis_1802 in this context, researchers can employ the following methodological approaches:

  • Transformation efficiency assays:

    • Generate Veis_1802 knockout or point mutations

    • Test natural transformation efficiency using standardized DNA substrates (e.g., pENTR/D:MCSkan-pilBC)

    • Perform time-course experiments to determine optimal transformation conditions

    • Quantify transformation frequencies by plating on selective media

  • Optimization of transformation conditions:

    • DNA concentration: 0.033-3.33 ng/μl (optimal: 0.667 ng/μl)

    • Incubation time: 6-24 hours

    • Cell density: Test range from 10^5 to 10^9 cells/mL

    • Nutritional supplements: Evaluate effects of various carbon sources (mannose, galactose, fructose, etc.)

  • Mechanistic investigations:

    • Test potential interactions between Veis_1802 and type IV pili components

    • Evaluate DNA binding capabilities through electrophoretic mobility shift assays

    • Assess cellular localization during natural transformation events

  • In vivo relevance:

    • Test transformation capabilities in egg capsule environments by injecting DNA carrying antibiotic resistance genes

    • Compare transformation frequencies between laboratory and natural conditions

This methodological framework allows for comprehensive investigation of whether and how Veis_1802 contributes to the natural transformation process that has been established as important for V. eiseniae genome maintenance and evolution .

How does Veis_1802 interact with bacterial cell division machinery?

As a probable intracellular septation protein, Veis_1802 likely interfaces with the bacterial cell division apparatus. While specific interaction data for Veis_1802 is not explicitly provided in the available research, methodological approaches to characterize these interactions include:

  • Protein-protein interaction analysis:

    • Bacterial two-hybrid systems to test direct interactions with known division proteins

    • Co-immunoprecipitation to identify binding partners in vivo

    • Crosslinking studies to capture transient interactions during division events

  • Localization studies:

    • Fluorescent protein fusions to track Veis_1802 localization during the cell cycle

    • Co-localization with established division markers (FtsZ, FtsA, etc.)

    • Time-lapse microscopy to correlate localization with division events

  • Division phenotype analysis:

    • Characterization of cell morphology in Veis_1802 mutants

    • Measurement of division timing and efficiency

    • Ultrastructural analysis of septum formation using electron microscopy

  • Genetic interaction mapping:

    • Synthetic lethality/sickness screens with other division genes

    • Suppressor screens to identify compensatory mutations

    • Transcriptional profiling to identify co-regulated genes

Understanding these interactions would provide mechanistic insights into how Veis_1802 contributes to bacterial cell division processes, which are essential for both bacterial growth and potentially for successful host colonization during symbiosis establishment.

What role might Veis_1802 play in bacterial motility and host colonization?

Research has established that V. eiseniae requires both flagella and type IV pili for motility and successful colonization of earthworm nephridia . While direct evidence for Veis_1802 involvement in motility or colonization is not explicitly provided in the available research, several methodological approaches can be employed to investigate potential connections:

  • Motility analysis:

    • Characterize swimming and twitching motility in Veis_1802 mutants

    • Examine flagellar and pili structure using electron microscopy

    • Measure colonization efficiency in earthworm models

  • Gene expression coordination:

    • Analyze co-regulation of Veis_1802 with motility genes

    • Examine potential effects of Veis_1802 mutations on motility gene expression

    • Test for interaction between Veis_1802 and motility regulators

  • Structural components analysis:

    • Investigate potential interactions with flagellar or type IV pili components

    • Assess effects of Veis_1802 mutations on flagella or pili assembly

    • Examine localization patterns relative to motility structures

  • Colonization studies:

    • Develop fluorescently labeled Veis_1802 mutants for tracking during colonization

    • Perform competitive colonization experiments between wild-type and mutant strains

    • Characterize temporal expression patterns during the colonization process

The established methods for studying V. eiseniae colonization involve introducing bacteria into earthworm egg capsules and tracking their migration into embryonic nephridia . These methods could be adapted to specifically examine the role of Veis_1802 in this process.

How can researchers differentiate between direct and indirect effects of Veis_1802 mutations?

Distinguishing between direct and indirect effects of Veis_1802 mutations presents a significant challenge in functional characterization. To address this challenge, researchers should implement a multi-faceted approach:

  • Complementation analysis:

    • Reintroduce wild-type Veis_1802 to confirm phenotype restoration

    • Use point mutations to identify critical functional residues

    • Perform domain swapping with homologous proteins to identify functional regions

  • Separation of phenotypes:

    • Characterize multiple phenotypic parameters independently

    • Establish temporal relationships between different phenotypic effects

    • Use conditional expression systems to control timing of protein availability

  • Biochemical validation:

    • Perform in vitro reconstitution of protein activities

    • Test direct interactions with proposed targets

    • Measure enzymatic activities if applicable

  • Systems biology approach:

    • Conduct transcriptomic and proteomic analyses to identify affected pathways

    • Map genetic interaction networks through synthetic genetic arrays

    • Develop computational models to predict and test causal relationships

  • Time-resolved analysis:

    • Use time-lapse microscopy to establish order of events

    • Implement inducible expression systems to control protein availability

    • Perform synchronized cell cycle studies to identify division-specific effects

This comprehensive approach allows researchers to build a causal model of Veis_1802 function, distinguishing direct molecular interactions from downstream consequences. Such differentiation is critical for accurate functional annotation and mechanistic understanding of this protein's role in V. eiseniae biology.

How can structural studies inform Veis_1802 function and interactions?

Structural characterization of Veis_1802 would provide crucial insights into its function and interaction mechanisms. As a membrane protein, structural studies present unique challenges that require specialized approaches:

  • Structural determination methods for membrane proteins:

    • X-ray crystallography with appropriate detergent solubilization

    • Cryo-electron microscopy for structure determination without crystallization

    • NMR spectroscopy for dynamics and interaction studies

    • Computational modeling based on homologous proteins

  • Structural insights to functional predictions:

    • Identification of potential active sites or binding pockets

    • Mapping of conserved residues onto the structure

    • Electrostatic surface analysis for potential interaction interfaces

    • Molecular dynamics simulations to predict conformational changes

  • Structure-guided experimentation:

    • Design of targeted mutations based on structural features

    • Development of structure-based inhibitors or activators

    • Engineering of protein variants with altered functional properties

  • Interaction mapping:

    • Co-crystallization with binding partners

    • Hydrogen-deuterium exchange mass spectrometry for interaction mapping

    • Cross-linking coupled with mass spectrometry for proximity mapping

The structural data would provide a framework for understanding how Veis_1802 integrates into the bacterial membrane, interacts with other cellular components, and potentially contributes to septation processes. This information is essential for developing a mechanistic model of Veis_1802 function in both bacterial physiology and symbiotic interactions.

What comparative genomics approaches can reveal about Veis_1802 evolution and conservation?

Comparative genomics offers powerful tools to understand the evolutionary history and functional conservation of Veis_1802. The following methodological framework would yield valuable insights:

  • Homology identification and phylogenetic analysis:

    • Identify Veis_1802 homologs across bacterial species

    • Construct phylogenetic trees to trace evolutionary history

    • Compare gene neighborhood and synteny across genomes

    • Analyze selection pressures through dN/dS ratio calculations

  • Symbiont-specific adaptations:

    • Compare Veis_1802 sequences between free-living relatives and symbionts

    • Identify symbiont-specific sequence signatures

    • Evaluate gene retention patterns in reduced symbiont genomes

    • Assess horizontal gene transfer potential

  • Functional divergence analysis:

    • Identify conserved domains and sequence motifs

    • Map conservation onto predicted structural models

    • Analyze co-evolution with interacting partners

    • Examine potential functional shifts across different bacterial lifestyles

  • Host-associated evolution:

    • Compare Veis_1802 sequences across symbionts of different hosts

    • Identify potential host-specific adaptations

    • Analyze co-evolution with host factors

    • Evaluate correlation between symbiont lifestyle and Veis_1802 sequence

This comparative approach would place Veis_1802 in its evolutionary context, revealing how its function may have been adapted or conserved during the establishment of the earthworm-Verminephrobacter symbiosis.

How can natural transformation capabilities of V. eiseniae be leveraged for genetic manipulation?

V. eiseniae possesses natural transformation capabilities that allow incorporation of free DNA from the environment . This ability can be leveraged for genetic manipulation using the following methodological approaches:

  • Transformation optimization protocol:

    • DNA concentration: Optimal transformation efficiency occurs at approximately 0.667 ng/μl

    • Incubation time: Transformants can be recovered between 6-24 hours post-DNA exposure

    • Cell density: Transformation efficiency varies with bacterial concentration

    • Nutritional conditions: Specific carbon sources can influence transformation rates

  • Selective DNA uptake mechanisms:

    • V. eiseniae demonstrates sequence-specific DNA uptake

    • Type IV pili are required for DNA uptake

    • DNase I (2 U/mL) can be used to halt DNA uptake after desired incubation periods

  • In vivo transformation applications:

    • DNA can be injected directly into egg capsules for transformation within the natural environment

    • This approach allows genetic manipulation of bacteria in their native symbiotic context

    • Antibiotic resistance genes can serve as selectable markers for transformed bacteria

  • Genetic tool development:

    • Creation of shuttle vectors compatible with V. eiseniae

    • Development of inducible expression systems

    • Implementation of CRISPR-Cas9 based genome editing

These methodologies provide researchers with tools to genetically manipulate V. eiseniae, enabling precise investigation of gene function, including Veis_1802, in its native context. The natural transformation capabilities offer unique advantages for genetic studies of this symbiotic bacterium, particularly for understanding its colonization mechanisms and symbiotic adaptations.

What statistical approaches are appropriate for analyzing Veis_1802 mutant phenotypes?

  • Experimental design considerations:

    • Include appropriate biological and technical replicates

    • Use randomization and blinding where applicable

    • Include appropriate controls (wild-type, vector-only, irrelevant gene mutations)

    • Determine sample size through power analysis

  • Quantitative phenotype analysis:

    • Growth rate comparisons: ANOVA with post-hoc tests for multiple strain comparisons

    • Survival/colonization efficiency: Log-rank tests for time-to-event data

    • Morphological measurements: Mixed-effects models to account for batch variation

    • Gene expression changes: Appropriate normalization and differential expression analysis

  • Data visualization:

    • Present data in tables for precise numerical values and small space

    • Use figures to show trends, patterns, and relationships between datasets

    • Reserve text for smaller datasets or when creating tables would mean having two or fewer columns

Data Presentation MethodBest Used ForExample Application for Veis_1802
TablesPrecise numerical values and specific data in small space Transformation efficiency under different conditions
FiguresTrends, patterns, and relationships across datasets Visualization of colonization patterns over time
TextSmall amounts of data Simple presence/absence of phenotypes
  • Advanced analytical approaches:

    • Multivariate analysis for complex phenotypes

    • Machine learning for pattern recognition in high-dimensional data

    • Network analysis for contextualizing Veis_1802 in broader cellular processes

    • Time-series analysis for dynamic processes

How should researchers document and present Veis_1802 localization data?

Proper documentation and presentation of Veis_1802 localization data is critical for understanding its subcellular distribution and potential functional implications. The following methodological framework provides guidance:

  • Imaging acquisition protocol:

    • Specify microscope specifications and settings (model, objectives, filters)

    • Document exposure times and image processing parameters

    • Include scale bars and time stamps for all images

    • Use appropriate controls (empty vector, non-specific localization marker)

  • Quantitative analysis of localization:

    • Employ automated image analysis for unbiased quantification

    • Measure co-localization with cellular landmarks using appropriate coefficients

    • Quantify fluorescence intensity profiles across cellular compartments

    • Analyze temporal dynamics if performing time-lapse imaging

  • Data presentation:

    • Present representative images alongside quantification

    • Use color-coding consistently and include separate channels for multi-color imaging

    • Provide magnified insets of regions of interest

    • Include multiple examples to demonstrate reproducibility

  • Statistical validation:

    • Quantify localization patterns across multiple cells and experiments

    • Apply appropriate statistical tests for distribution comparisons

    • Report sample sizes and variation metrics

    • Validate observations using complementary techniques (e.g., biochemical fractionation)

  • Contextual interpretation:

    • Correlate localization patterns with cellular events (division, motility)

    • Compare localization under different conditions (growth phases, stress)

    • Examine co-localization with potential interaction partners

    • Integrate localization data with functional assays

This comprehensive approach ensures that localization data is acquired, analyzed, and presented in a manner that allows for robust interpretation and integration with other experimental data on Veis_1802 function.

What are the best practices for presenting comparative data from Veis_1802 mutants?

Effective presentation of comparative data from Veis_1802 mutants requires careful consideration of data organization, visualization, and statistical analysis. The following best practices should be implemented:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.