Recombinant Verminephrobacter eiseniae UPF0761 membrane protein Veis_3782 (Veis_3782)

Shipped with Ice Packs
In Stock

Description

Biological Origin and Taxonomic Context

Verminephrobacter eiseniae is a Gram-negative bacterium belonging to the phylum Pseudomonadota, class Betaproteobacteria, order Burkholderiales, and family Comamonadaceae . This bacterial species has evolved a specialized symbiotic relationship with lumbricid earthworms, particularly Eisenia fetida, where it colonizes the nephridia, which function as excretory organs . The symbiotic relationship begins during earthworm reproduction, where E. fetida transfers V. eiseniae into the egg capsule albumin during capsule formation . The bacterial cells then migrate into the earthworm nephridia during embryogenesis, where they establish a stable colonization .

Research has demonstrated that V. eiseniae utilizes both flagella and type IV pili for motility, which are essential for successful colonization of earthworm nephridia during embryonic development . This specialized colonization mechanism highlights the evolutionary adaptations of this bacterium to its symbiotic lifestyle with earthworm hosts. The Veis_3782 gene encodes a membrane protein that may contribute to the bacterium's cellular functions and potentially to its symbiotic relationship, though specific research on this protein's role in symbiosis is currently limited.

Identification and Database Information

The Veis_3782 protein has been cataloged in protein databases with the following identifiers:

ParameterInformation
UniProt IDA1WPD7
Gene NameVeis_3782
SynonymsUPF0761 membrane protein Veis_3782
Expression Region1-417 (Full Length)
OrganismVerminephrobacter eiseniae (strain EF01-2)

This database information provides essential reference points for researchers working with this protein and facilitates cross-referencing with other protein databases and literature .

Expression Systems

For research applications, the Veis_3782 protein is typically produced as a recombinant protein using Escherichia coli expression systems . The commercially available recombinant forms feature N-terminal histidine tags (His-tags), which facilitate purification through affinity chromatography methods . This approach allows for the isolation of relatively pure protein suitable for various research applications.

The expression of this membrane protein in E. coli represents a significant technical achievement, as membrane proteins can be challenging to express in heterologous systems due to their hydrophobic nature and the potential for toxicity to the host organism. Successful expression indicates the optimization of production protocols for this specific protein.

For lyophilized preparations, specific reconstitution protocols are recommended:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom.

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  3. Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation).

  4. Aliquot for long-term storage at -20°C/-80°C .

These protocols aim to maximize protein stability while minimizing degradation during the reconstitution process. Following these guidelines ensures the maintenance of protein integrity for subsequent experimental applications.

Membrane Protein Role

As a membrane protein, Veis_3782 likely plays a role in maintaining cell membrane structure, transport processes, or cellular signaling. The UPF0761 designation indicates that this protein belongs to a family with unknown function, suggesting that its specific biological roles have not been fully characterized . The presence of multiple hydrophobic regions in its sequence supports its classification as a membrane protein, which typically contains transmembrane domains that anchor the protein within the lipid bilayer.

Membrane proteins in bacteria can serve various functions, including:

  • Structural support for the cell membrane

  • Transport of molecules across the membrane

  • Cell-cell signaling

  • Environmental sensing

  • Enzymatic activities

  • Adhesion to surfaces or host tissues

Without specific functional studies on Veis_3782, its exact role within these categories remains speculative.

Potential Role in Symbiosis

Given that V. eiseniae is a symbiotic bacterium that colonizes earthworm nephridia, it is possible that Veis_3782 may contribute to this symbiotic relationship. Research has shown that V. eiseniae requires both flagella and type IV pili for motility and successful colonization of earthworm nephridia . While there is no direct evidence linking Veis_3782 to these colonization mechanisms, as a membrane protein, it could potentially be involved in:

  • Adhesion to host tissues

  • Sensing environmental cues within the earthworm

  • Adaptation to the unique environment of earthworm nephridia

  • Transport of nutrients or metabolites related to the symbiotic relationship

Further research specifically targeting the function of Veis_3782 in the context of the V. eiseniae-earthworm symbiosis would be valuable for understanding its biological significance.

Research Applications

The recombinant Veis_3782 protein has potential applications in various research areas, including:

Functional Characterization

Biochemical and cell biological assays using the recombinant protein could help determine its function. Potential approaches include:

  • Protein-protein interaction studies to identify binding partners

  • Lipid binding assays to evaluate membrane interactions

  • Transport assays if the protein functions as a transporter

  • Enzymatic activity assays if the protein possesses catalytic functions

Antibody Production

The recombinant protein can be used to generate antibodies for immunological detection of the native protein in V. eiseniae. Such antibodies would facilitate localization studies to determine where the protein is expressed within the bacterial cell and potentially within colonized earthworm tissues.

Symbiosis Research

As V. eiseniae is a model organism for studying bacterial-earthworm symbiosis, the recombinant Veis_3782 protein could be used in experiments investigating the molecular basis of this relationship. This might include studies on protein localization during colonization or functional assays in mutant bacteria lacking this protein.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Veis_3782; UPF0761 membrane protein Veis_3782
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-417
Protein Length
full length protein
Species
Verminephrobacter eiseniae (strain EF01-2)
Target Names
Veis_3782
Target Protein Sequence
MSLPFSLSVAARRIEALLGDLSRFPWKTTAQTLRERFRADHLGLTASSLTFTTILALVPF FTVALAVFTAFPIFGQLQDALQGWLVSSLVPDSIARQVLGYLTQFAAKASGLGLAGFSVL LVTALALILTIDRTLNDIWRVQRLRPLGQRVLIYWAAITLGPLLLGASLALTSYVMSASG GLVKRLPDGVRFLFDSLQFMVLAAGMALLYHYVPNTPVRWRHAWSGGLFVALCIELAKKA LALYLGRVPTYSVVYGAFATLPILLVWIYMAWVIVLLGAVVTAYLPSLLAGVARRGTVAG WTFQLALEVLQQLHRVRHDAGKGLRAGQLAQLLRVDVLQLEPVLESLTALDWVGQVSAVV VAASDPPEPRYVLLADPQSTLLEPLVHKLLLERSESLGPLWDKAGLGRLQMADVLAR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Verminephrobacter eiseniae and what is its biological significance?

Verminephrobacter eiseniae is a Gram-negative, flagellated, heterotrophic, catalase-negative, rod-shaped bacterium identified as an earthworm symbiont isolated from nephridia of the earthworm Eisenia foetida. The bacterium belongs to the Betaproteobacteria class and shares phylogenetic relatedness to the genus Acidovorax, with sequence similarity between 92-94% to recognized species within this genus .

Biologically, V. eiseniae represents a distinct clade of earthworm symbionts with unique ecological significance. The bacterium has specific growth preferences, favoring low oxygen concentrations despite its ability to grow in fully aerated media. It requires either biotin or a mixture of amino acids to grow on defined mineral media, indicating specialized metabolic requirements . The symbiotic relationship with earthworms suggests evolutionary adaptations for this specialized niche, making it an important model organism for studying host-microbe interactions.

How is recombinant Veis_3782 typically expressed and purified for research applications?

Recombinant Veis_3782 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The full-length protein (amino acids 1-417) is cloned into appropriate expression vectors and transformed into E. coli strains optimized for membrane protein expression.

The standard purification protocol involves:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents

  • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Size exclusion chromatography for further purification if needed

  • Quality assessment using SDS-PAGE to confirm purity (>90%)

After purification, the protein is typically formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, then lyophilized for long-term storage and stability .

What experimental design considerations are crucial when working with Veis_3782?

When designing experiments with Veis_3782, researchers must carefully consider several critical factors to ensure valid results:

  • Variable identification and control: Clearly define independent variables (e.g., protein concentration, experimental conditions) and dependent variables (e.g., binding affinity, functional activity) while controlling extraneous variables that might influence results .

  • Experimental treatments: Design treatments that systematically manipulate independent variables to test specific hypotheses about Veis_3782 function . For example:

    TreatmentProtein ConcentrationBuffer ConditionsTemperaturePurpose
    Control0 μg/mLStandard25°CBaseline measurement
    Test 110 μg/mLStandard25°CDose response
    Test 210 μg/mLAcidic (pH 6.0)25°CpH sensitivity
    Test 310 μg/mLStandard37°CTemperature effect
  • Sample assignment: Utilize either between-subjects (different samples for each condition) or within-subjects (same sample across conditions) designs appropriately .

  • Measurement precision: Plan precise methods for dependent variable measurement, with appropriate replicates to ensure statistical power .

  • Control for membrane protein-specific challenges: Account for detergent effects, protein orientation, and lipid environment when studying membrane proteins like Veis_3782.

How can researchers investigate the potential symbiotic functions of Veis_3782 in the context of earthworm-bacteria interactions?

Investigating the symbiotic functions of Veis_3782 requires a multidisciplinary approach:

  • Comparative genomics and transcriptomics:

    • Compare Veis_3782 expression levels in symbiotic versus free-living conditions

    • Analyze gene expression patterns in different earthworm tissues

    • Identify co-expressed genes that might function in related pathways

  • Localization studies:

    • Use immunofluorescence with anti-His antibodies against recombinant Veis_3782

    • Determine spatial distribution within earthworm nephridia

    • Correlate localization with potential functional sites

  • Functional disruption experiments:

    • Design gene knockout or knockdown systems

    • Observe phenotypic changes in host-microbe interactions

    • Complement with recombinant Veis_3782 to confirm specificity

  • Protein-protein interaction studies:

    • Identify earthworm host proteins that interact with Veis_3782

    • Use pull-down assays with His-tagged Veis_3782 as bait

    • Validate interactions using techniques like biolayer interferometry

  • Metabolic analysis:

    • Investigate metabolic changes in the presence/absence of functional Veis_3782

    • Correlate with V. eiseniae's requirements for biotin or amino acids

This integrated approach allows researchers to connect molecular mechanisms to ecological functions within the symbiotic relationship.

What methodological approaches can resolve challenges in membrane topology determination for Veis_3782?

Determining membrane topology of Veis_3782 presents specific challenges that can be addressed through complementary approaches:

  • Computational prediction:

    • Utilize multiple topology prediction algorithms (TMHMM, TOPCONS, MEMSAT)

    • Identify consensus transmembrane regions and orientation

    • Generate initial models for experimental validation

  • Accessibility mapping:

    • Use cysteine scanning mutagenesis with membrane-impermeable reagents

    • Introduce single cysteine residues at various positions

    • Determine accessibility to differentiate cytoplasmic from periplasmic regions

  • Reporter fusion analysis:

    • Create fusion constructs with reporter proteins (GFP, PhoA, LacZ)

    • Express truncated versions with reporters at different positions

    • Analyze reporter activity to determine orientation

  • Protease protection assays:

    • Subject membrane preparations to controlled protease digestion

    • Analyze protected fragments by mass spectrometry

    • Identify regions embedded within the membrane

  • Structural biology approaches:

    • Utilize X-ray crystallography (challenging for membrane proteins)

    • Apply cryo-electron microscopy for 3D structure determination

    • Consider solid-state NMR for specific structural elements

A systematic integration of these methodologies provides robust evidence for the membrane topology of Veis_3782, essential for understanding its function in symbiotic interactions.

What are the optimal storage and handling conditions for recombinant Veis_3782?

Proper storage and handling of recombinant Veis_3782 is critical for maintaining protein integrity and experimental reproducibility. Based on established protocols, the following guidelines should be followed:

  • Long-term storage:

    • Store lyophilized protein at -20°C to -80°C upon receipt

    • For extended storage, -80°C is preferred to minimize degradation

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to collect contents

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for stability

  • Working solution handling:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces activity

    • Maintain pH at approximately 8.0 for optimal stability

  • Buffer considerations:

    • Standard storage in Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Alternative: Tris-based buffer with 50% glycerol

    • Buffer selection should align with downstream applications

Following these storage and handling protocols ensures that the recombinant protein maintains its structural integrity and functional properties for experimental use.

How can researchers validate the functional integrity of purified Veis_3782?

Validating the functional integrity of purified Veis_3782 is essential before proceeding with complex experiments. Multiple complementary approaches should be employed:

  • Structural integrity assessment:

    • SDS-PAGE analysis to confirm molecular weight (expected size with His-tag)

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size exclusion chromatography to detect aggregation or degradation

  • Functional assays (to be designed based on predicted function):

    • Binding assays if ligands are identified

    • Enzymatic activity tests if catalytic function is suspected

    • Transport assays if membrane transport is a potential function

  • Thermal stability analysis:

    • Differential scanning fluorimetry (DSF) to determine melting temperature

    • Compare fresh versus stored samples to detect loss of stability

    • Evaluate effects of different buffer compositions on stability

  • Tag functionality verification:

    • Western blot with anti-His antibodies to confirm tag accessibility

    • Ni-NTA binding assay to verify tag functionality

    • Ensure tag doesn't interfere with protein function

  • Quality control parameters:

    • Purity should exceed 90% as determined by SDS-PAGE

    • Endotoxin testing for experiments sensitive to bacterial contaminants

    • Batch-to-batch consistency validation for long-term studies

Systematic application of these validation methods ensures that experimental observations can be confidently attributed to functionally intact Veis_3782.

How can researchers effectively compare Veis_3782 with homologous proteins from related bacterial species?

Effective comparison of Veis_3782 with homologous proteins requires systematic bioinformatic and experimental approaches:

  • Sequence-based analysis:

    • Perform BLAST searches against protein databases

    • Conduct multiple sequence alignments with identified homologs

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains and motifs

    SpeciesProtein AccessionSequence Identity (%)Similarity (%)E-value
    V. eiseniaeA1WPD71001000.0
    Acidovorax sp.[Example][70-80][85-90][Value]
    Other species[Example][Value][Value][Value]
  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Evaluate evolutionary relationships between Veis_3782 and homologs

    • Identify potential horizontal gene transfer events

    • Correlate phylogeny with host symbiotic relationships

  • Structural comparison:

    • Generate homology models based on crystal structures of homologs

    • Compare predicted secondary and tertiary structures

    • Identify structurally conserved regions potentially important for function

    • Analyze conservation of membrane-spanning regions

  • Functional comparison:

    • Compare expression patterns in similar ecological contexts

    • Evaluate complementation capacity in cross-species experiments

    • Assess functional conservation through domain swapping

    • Correlate genetic proximity with functional similarity

  • Ecological context comparison:

    • Analyze the role of homologs in their respective bacterial species

    • Compare symbiotic versus free-living related species

    • Evaluate potential adaptation signatures in symbiotic homologs

    • Consider evolutionary aspects of host-microbe co-evolution

This multifaceted comparative approach provides insights into the evolutionary history, functional conservation, and potential specialized adaptations of Veis_3782 in the context of earthworm symbiosis.

What approaches can help researchers resolve contradictory experimental results when studying Veis_3782?

When facing contradictory results in Veis_3782 research, a systematic troubleshooting approach is essential:

  • Methodological validation:

    • Reassess experimental design for confounding variables

    • Evaluate statistical power and sample size adequacy

    • Verify reagent quality and experimental conditions

    • Implement additional controls specific to membrane proteins

  • Protein state assessment:

    • Confirm protein integrity before and after experiments

    • Evaluate effects of different detergents on protein behavior

    • Test for time-dependent degradation or aggregation

    • Consider post-translational modifications or conformational changes

  • Comparative validation:

    • Replicate experiments using different methodological approaches

    • Compare results from multiple independent research groups

    • Test under varied conditions to identify context-dependent effects

    • Use orthogonal techniques to validate observations

  • Biological context considerations:

    • Assess whether contradictions reflect true biological variability

    • Consider the impact of experimental systems (in vitro vs. in vivo)

    • Evaluate potential strain-specific or host-specific effects

    • Analyze whether contradictions reflect different functional states

  • Systematic reconciliation strategy:

    • Develop a unified model that accommodates seemingly contradictory results

    • Design critical experiments to specifically address contradictions

    • Use mathematical modeling to identify parameters causing variability

    • Consider whether contradictions reflect previously unrecognized complexity

Through systematic assessment of experimental variables and biological context, researchers can transform contradictory results into deeper insights about Veis_3782 function and behavior.

What emerging technologies might advance our understanding of Veis_3782 function?

Several cutting-edge technologies hold promise for elucidating the function of Veis_3782:

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics

    • Atomic force microscopy for topological analysis

    • Single-molecule tracking in reconstituted membrane systems

    • Correlate structural changes with potential transport or signaling functions

  • Advanced structural biology approaches:

    • Cryo-EM for high-resolution structural determination

    • Integrative structural biology combining multiple data sources

    • Time-resolved structural studies to capture conformational changes

    • Computational approaches for membrane protein modeling

  • Functional genomics tools:

    • CRISPR-Cas9 genome editing in V. eiseniae

    • CRISPRi for conditional knockdown studies

    • High-throughput mutational scanning

    • Synthetic biology approaches to engineer functional variants

  • Systems biology integration:

    • Multi-omics approaches (proteomics, metabolomics, transcriptomics)

    • Network analysis to position Veis_3782 in cellular pathways

    • Mathematical modeling of symbiotic interactions

    • Integration of data across molecular, cellular, and ecological scales

  • Advanced imaging technologies:

    • Super-resolution microscopy for subcellular localization

    • Correlative light and electron microscopy

    • Live-cell imaging in symbiotic contexts

    • Label-free imaging techniques for non-invasive monitoring

These emerging technologies, applied in combination, will likely resolve currently unanswered questions about the structure, function, and ecological significance of Veis_3782 in earthworm-bacteria symbiosis.

How might researchers design experiments to elucidate the potential role of Veis_3782 in bacterial adaptation to the earthworm nephridial environment?

Investigating Veis_3782's role in adaptation to the nephridial environment requires carefully designed experiments:

  • Comparative expression analysis:

    • Compare Veis_3782 expression across different microenvironments

    • Design experiment measuring expression under varying oxygen levels

    • Evaluate expression in response to nephridial fluid components

    • Analyze temporal expression patterns during colonization

    ConditionOxygen LevelBiotin LevelpHExpression Level
    Free-livingAmbientNone7.0Baseline
    Low O₂5%None7.0[Measured]
    Nephridial simulation5%High6.5[Measured]
    In vivo nephridiaNaturalNaturalNatural[Measured]
  • Mutational analysis:

    • Create knockout mutants lacking functional Veis_3782

    • Assess colonization efficiency in earthworm nephridia

    • Measure competitive fitness versus wild-type bacteria

    • Evaluate survival under nephridia-specific stressors

  • Heterologous expression studies:

    • Express Veis_3782 in non-symbiotic bacterial species

    • Test conferred advantages in nephridia-like conditions

    • Measure growth rates, survival, and competitive fitness

    • Identify gain-of-function phenotypes

  • Biochemical characterization in relevant conditions:

    • Assess protein stability and function at varying oxygen tensions

    • Test activity in the presence of nephridial fluid components

    • Evaluate interaction with earthworm host proteins

    • Measure transport or enzymatic activities under physiological conditions

  • In situ visualization:

    • Develop specific antibodies against Veis_3782

    • Visualize protein localization within the nephridial environment

    • Correlate distribution with functional microniches

    • Track dynamics during colonization and symbiosis establishment

This experimental framework integrates molecular mechanisms with ecological function, providing insights into how Veis_3782 potentially facilitates bacterial adaptation to the specialized nephridial environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.