Recombinant Verticillium albo-atrum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

How conserved is AIM31 across different fungal species?

AIM31 appears to be highly conserved across many fungal species, particularly within the Verticillium genus. Phylogenetic analysis of the homologous protein VdNuo1 in V. dahliae showed that it shares the closest evolutionary relationship within Verticillium species, while still being conserved across filamentous fungi from a common ancestral origin .

The conservation can be observed across multiple species for which recombinant AIM31 proteins are available, including:

• Verticillium albo-atrum

• Penicillium chrysogenum

• Saccharomyces cerevisiae

• Pichia pastoris

• Aspergillus flavus

• Paracoccidioides brasiliensis

• Trichophyton verrucosum

• Arthroderma otae

• Penicillium marneffei

• Ajellomyces dermatitidis

• Aspergillus clavatus

This conservation suggests evolutionary importance of this protein in mitochondrial function across the fungal kingdom.

What detection methods are available for studying Verticillium albo-atrum in plant samples?

Several detection methods have been developed for V. albo-atrum in plant samples, with quantitative PCR being particularly effective:

Real-time PCR assay:
A precise real-time polymerase chain reaction (PCR) assay has been developed specifically for quantifying Verticillium albo-atrum DNA in plant tissues. This method allows researchers to:

• Quantify pathogen DNA in infected leaves and shoots

• Correlate DNA quantities with disease severity

• Examine relationships between pathogen colonization and host resistance

In experimental studies, this PCR-based method demonstrated significant correlation (>0.52, P < 0.0001) between the amount of V. albo-atrum DNA detected in leaves and stems and disease severity index ratings from visual symptoms .

Other detection approaches include:

• Microscopic examination of infected tissues

• Culture-based isolation on selective media

• Species-specific molecular markers based on mitochondrial genome features

• Immunological detection methods using antibodies against fungal antigens

What is the relationship between AIM31 and mitochondrial function in Verticillium species?

AIM31 appears to be a key component in mitochondrial function, particularly in maintaining mitochondrial integrity and respiratory chain activity. Studies on the homologous protein VdNuo1 in V. dahliae provide insights:

• Subcellular localization: The protein is definitively localized to mitochondria, as confirmed by co-localization of GFP-fusion proteins with mitochondrial-specific probes .

• Structural features: The protein contains a conserved mitochondrial presequence and a TRX-like [2Fe-2S] ferredoxin family domain that facilitates electron transfer .

• Functional impact: Deletion of the homologous gene in V. dahliae led to:

  • Formation of giant lipid droplets

  • Dispersion of outer mitochondrial membrane

  • Fusion of the matrix with cristae

  • Increased sensitivity to mitochondrial reactive oxygen species (mtROS) inducers

These findings suggest that AIM31 likely plays crucial roles in maintaining mitochondrial morphology, electron transport chain function, and potentially in oxidative stress responses in V. albo-atrum as well.

What expression systems are optimal for producing recombinant Verticillium albo-atrum AIM31 protein?

Multiple expression systems have been successfully used to produce recombinant AIM31 protein, each with advantages for different research purposes:

When selecting an expression system, researchers should consider:

• The need for post-translational modifications

• Required protein yield

• Downstream applications (structural studies vs. functional assays)

• Available laboratory resources and expertise

For structural studies requiring large quantities of protein, E. coli expression is generally preferred, while functional studies may benefit from expression in systems that better preserve native protein conformation and modifications .

What methodologies are effective for studying AIM31 localization in fungal cells?

Several methodologies have proven effective for studying the subcellular localization of AIM31 and related proteins in fungal cells:

Fluorescent protein fusion approaches:

• GFP fusion constructs: The coding sequence region of the target gene (without stop codon) can be fused with GFP fragments and inserted into appropriate vectors using homologous recombination .

• Transformation methods: Agrobacterium tumefaciens-mediated transformation (ATMT) has been successfully used to introduce these constructs into fungal cells .

• Visualization: Confocal microscopy with appropriate filter sets (Ex 470 nm, Em 525 nm for GFP) allows visualization of the fusion protein's location .

Co-localization with mitochondrial markers:

• Mitochondrial staining: Mitochondrial-specific probes such as MitoTracker Red CMXRos (200 nM) can be used to confirm mitochondrial localization .

• Fluorescence overlay: The intensity of green (GFP) and red (mitochondrial marker) fluorescence can be quantified and compared using image analysis software like ImageJ to confirm co-localization .

Electron microscopy approaches:
For higher resolution studies of mitochondrial morphology and AIM31 localization:

• Samples should be processed through fixation (2.5% glutaraldehyde), post-fixation (1% osmium tetroxide), dehydration, and embedding

• Ultrathin sections can be examined by transmission electron microscopy (typically at 80 kV)

A detailed protocol used successfully for similar proteins includes:

• Collection of conidia from appropriate culture plates

• Incubation of spore suspensions (10⁴ spores/mL) on hydrophobic glass slides for 16h at 25°C

• Staining with mitochondrial probe (200 nM) and washing

• Observation using appropriate fluorescence microscopy channels

What role does AIM31 play in mitochondrial inheritance and pathogenesis in Verticillium albo-atrum?

The role of AIM31 in mitochondrial inheritance and pathogenesis appears to be multifaceted, based on studies of related proteins:

Mitochondrial inheritance aspects:

• AIM31 likely contributes to maintaining mitochondrial morphology and integrity, which is essential for proper inheritance during cell division

• The protein appears to be involved in respiratory chain complex assembly and function, which impacts energy production during critical developmental stages

• The name "Altered inheritance of mitochondria protein" suggests its fundamental role in ensuring proper mitochondrial distribution and function during fungal reproduction

Pathogenesis mechanisms:
Studies on the related protein VdNuo1 in V. dahliae revealed:

• The protein is induced during multiple developmental stages including hyphal growth, conidiation, and melanized microsclerotia development - all critical for pathogenesis

• Deletion mutants showed decreased virulence across multiple host plants

• Transcriptome analysis indicated that the protein mediates global transcriptional effects on metabolic processes essential for pathogen survival in the host

The relationship between mitochondrial function and virulence is further supported by research showing that resistance to Verticillium wilt in plants like tomato and alfalfa is characterized by reduced colonization of resistant genotypes by the fungus , suggesting that proteins like AIM31 that support robust fungal growth and stress tolerance are likely important virulence factors.

How can researchers design effective inhibitors targeting the AIM31 protein for potential disease control?

Designing effective inhibitors targeting AIM31 for potential control of Verticillium wilt diseases requires a systematic approach:

Structural information utilization:

• The amino acid sequence of V. albo-atrum AIM31 suggests it contains a TRX-like [2Fe-2S] ferredoxin family domain with specific residues (like 136C, 141C, 179C, and 183C in the homologous VdNuo1) involved in binding iron-sulfur clusters

• These specific binding sites could serve as targets for rational inhibitor design

• Virtual screening against these sites may identify compounds that disrupt protein function

Target validation approaches:

• Gene knockout studies: Confirm whether AIM31 is essential for fungal virulence using CRISPR-Cas9 or other gene editing technologies

• Complementation assays: Evaluate whether wild-type protein can restore function in mutants to confirm specificity

• Host range testing: Determine if similar phenotypes occur across different host plants to ensure broad-spectrum efficacy

High-throughput screening strategies:

• Develop biochemical assays measuring AIM31 activity (e.g., electron transfer function)

• Screen chemical libraries against recombinant protein

• Evaluate mitochondrial function inhibitors for selective activity against fungal vs. plant mitochondria

Evaluation of candidate inhibitors:

• In vitro assays: Test effects on fungal growth, development, and stress responses

• Ex vivo plant infection assays: Assess impact on disease progression

• Selectivity profiling: Ensure minimal effects on non-target organisms

• Resistance development assessment: Evaluate potential for resistance emergence

The research on mitochondrial complex inhibitors suggests that compounds affecting mitochondrial superoxide anion detoxification might be particularly effective, as VdNuo1 mutants showed significantly increased sensitivity to menadione (an mtROS inducer) .

What methodologies can be used to study the interaction between AIM31 and other mitochondrial proteins in Verticillium species?

Several complementary methodologies can be employed to study AIM31 protein interactions:

Protein-protein interaction studies:

• Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of AIM31 to pull down interacting proteins, followed by mass spectrometry identification

• Yeast two-hybrid screening: Using AIM31 as bait to identify interacting partners from a cDNA library

• Proximity-dependent biotin identification (BioID): Fusing AIM31 to a biotin ligase to biotinylate nearby proteins for subsequent identification

Structural biology approaches:

• X-ray crystallography or cryo-EM: To determine the three-dimensional structure of AIM31 complexes

• Cross-linking mass spectrometry: To identify points of contact between AIM31 and other proteins

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction interfaces

Functional genomics approaches:

• Synthetic genetic arrays: Identifying genes that show synthetic lethality or suppression with AIM31 mutations

• CRISPR-Cas9 screening: For identifying functionally related genes

• Comparative transcriptomics: Between wild-type and AIM31 mutants to identify co-regulated genes

Biochemical complex analysis:

• Blue native PAGE: To isolate and identify intact mitochondrial complexes containing AIM31

• Density gradient ultracentrifugation: To separate and characterize complexes

• Reconstitution experiments: With purified components to test direct interactions

In vivo imaging:

• Bimolecular fluorescence complementation (BiFC): To visualize protein interactions in living cells

• Förster resonance energy transfer (FRET): To detect proximity between fluorescently tagged proteins

• Super-resolution microscopy: To visualize co-localization at the nanoscale

Research on the related protein VdNuo1 identified it as regulating mitochondrial morphogenesis and homeostasis, suggesting that AIM31 likely interacts with proteins involved in mitochondrial fusion/fission machinery, cristae formation, and respiratory chain complexes .

How does the genomic context of AIM31 in Verticillium albo-atrum influence its expression and function?

Understanding the genomic context of AIM31 requires examining DNA methylation patterns, chromatin structure, and genomic location:

Research on V. dahliae has shown that DNA methylation patterns influence gene expression, particularly in genomic regions containing transposable elements . The genomic location of AIM31 relative to these methylated regions could influence its expression patterns.

Studies have identified that certain genes in Verticillium species reside in hypervariable "adaptive genomic regions" that contain genes associated with host colonization . Determining whether AIM31 resides within such regions or in the more stable core genome would provide insights into its evolutionary trajectory and potential role in host adaptation.

Additionally, mitochondrial-encoded genes in Verticillium species show highly conserved synteny between species such as V. dahliae and V. nonalfalfae , suggesting evolutionary constraints on mitochondrial function. Comparative genomic analysis could reveal whether nuclear-encoded mitochondrial proteins like AIM31 show similar conservation patterns.

What are the best approaches for purifying recombinant AIM31 protein while maintaining its structural integrity?

Purification of recombinant AIM31 requires careful consideration of protein characteristics:

Optimized purification strategy:

• Expression conditions: Low-temperature induction (16-18°C) may enhance proper folding

• Cell lysis: Gentle lysis methods using enzymatic or pressure-based approaches rather than harsh detergents

• Affinity chromatography: His-tag purification under native conditions with imidazole gradient elution

• Buffer optimization: Including glycerol (typically 50%) and optimized Tris-based buffers to maintain stability

• Storage considerations: Store at -20°C or -80°C for extended periods, with working aliquots at 4°C for up to one week

Quality control methods:

• Purity assessment: SDS-PAGE analysis (target >85% purity)

• Activity assays: Functional tests based on electron transfer capabilities

• Structural integrity: Circular dichroism or thermal shift assays to confirm proper folding

The specific amino acid sequence of AIM31 (for example, V. albo-atrum AIM31: MPNVDDSVMGRQMPSSFDENHEFYNEKPMAKIFRKLREEPLIPLGAGLTVFAFTQAWRPMRRGDQVSANKMFRARVAAQGFTVLAMIAGSMYYNKDREATKELRKLKEERDSEEKRQKWIRELEIRDEEDKAMRARVMNRRAKAEEAKAGNASATPAEGGEAKSGVLNALGLSGSSSGWGKPGEAPLADASKAVDDEPIVSKVKTPTNVKRVSAEDDKTN) suggests potential challenges in maintaining solubility and proper folding that must be considered during purification design.

How can AIM31 be utilized in developing diagnostic tools for Verticillium wilt detection?

AIM31 protein or its encoding gene could potentially serve as a target for developing novel diagnostic tools:

PCR-based detection approaches:

• Quantitative PCR assays: Similar to existing assays for V. albo-atrum detection , primers targeting the AIM31 gene could provide species-specific detection

• Digital PCR: For absolute quantification in field samples with potentially inhibitory compounds

Protein-based detection methods:

• Immunoassays: Development of antibodies against recombinant AIM31 for ELISA-based detection

• Lateral flow devices: For rapid field-based detection using AIM31-specific antibodies

Advanced molecular methods:

• Loop-mediated isothermal amplification (LAMP): For field-deployable detection without thermal cycling equipment

• CRISPR-based detection: Utilizing CRISPR-Cas systems for highly specific DNA detection

The development of such diagnostic tools could significantly improve:

• Early detection before symptom development

• Distinction between Verticillium species in mixed infections

• Quantitative assessment of fungal biomass correlating with disease severity

• Monitoring of treatment efficacy