Recombinant Verticillium albo-atrum Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Table 1: LCL3 Sequence and Expression Details

ParameterDetail
Amino Acid SequenceMPWPFGPSGSSEAPPPQKPRDDKVEGREPAKSWNSLLPKPDPPLQAAKEWAPVFLTAVGSLAAFMFYQSYLRRFAGAASIQENFFRKRSLLGRVTSVGDGDGFHLYHTPGGKLAGWGWLRKIPEGRSNLKGETISIRLAGIDAPEGPHFGRPGQPFAAEAQAHLSKYILHRRVRAHLHKR DQYNRIVATVSTRQPFIKKDVGLEmLKQGLATTYEAKSGVEWGGKESIYKAAEAKAKAKK LGLWSIKASEFESPRDFKNRTQGNEKSERDVEGSTVQKPWWRRWLTG
Expression Region1–287 (full-length protein)
Post-Translational ModificationsNo glycosylation sites predicted; potential phosphorylation sites identified via in silico analysis .

Applications in Research

LCL3 is commercially available as an ELISA recombinant protein (e.g., Cusabio, Cat No: CSB-CF514986VES), with applications including:

  • Antibody Production: Used as an immunogen to generate polyclonal or monoclonal antibodies for detecting V. albo-atrum in plant tissues .

  • Enzymatic Assays: Preliminary studies suggest its utility in in vitro assays to characterize fungal endonuclease activity under varying pH and temperature conditions .

Research Gaps and Future Directions

  • Mechanistic Studies: No peer-reviewed publications directly characterize LCL3’s biochemical activity or its role in V. albo-atrum pathogenicity.

  • Host Interaction: Potential interactions with plant immune components (e.g., ROS pathways, ethylene signaling) remain unexplored .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
LCL3; VDBG_04704; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum)
Target Names
LCL3
Target Protein Sequence
MPWPFGPSGSSEAPPPQKPRDDKVEGREPAKSWNSLLPKPDPPLQAAKEWAPVFLTAVGS LAAFMFYQSYLRRFAGAASIQENFFRKRSLLGRVTSVGDGDGFHLYHTPGGKLAGWGWLR KIPEGRSNLKGETISIRLAGIDAPEGPHFGRPGQPFAAEAQAHLSKYILHRRVRAHLHKR DQYNRIVATVSTRQPFIKKDVGLEMLKQGLATTYEAKSGVEWGGKESIYKAAEAKAKAKK LGLWSIKASEFESPRDFKNRTQGNEKSERDVEGSTVQKPWWRRWLTG
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is the optimal expression system for recombinant production of Verticillium albo-atrum LCL3?

The optimal expression system depends on your downstream applications and required protein modifications. For LCL3 expression, Escherichia coli BL21(DE3) typically yields high protein quantities for basic structural studies, while Pichia pastoris is preferred when post-translational modifications are critical. For functional studies that require native-like folding and glycosylation patterns, insect cell systems (Sf9 or Hi5) often provide better results .

When expressing in E. coli, consider these optimization parameters:

  • Temperature: 16-18°C after induction minimizes inclusion body formation

  • IPTG concentration: 0.1-0.5 mM typically balances yield and solubility

  • Expression duration: 16-20 hours at reduced temperatures improves folding

For expression in eukaryotic systems, secretory leader sequences often improve yield. The native signal peptide from V. albo-atrum can be used, though the α-factor from Saccharomyces cerevisiae frequently provides superior secretion efficiency in Pichia systems .

What purification strategy yields the highest purity and activity for recombinant LCL3?

A multi-step purification approach is recommended for obtaining high-purity, active LCL3. Begin with immobilized metal affinity chromatography (IMAC) using a histidine tag, followed by ion-exchange chromatography and size-exclusion chromatography .

Representative purification protocol:

  • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and 1 mM PMSF

  • Apply cleared lysate to Ni-NTA column

  • Wash with increasing imidazole concentrations (20-50 mM)

  • Elute with 250 mM imidazole

  • Apply to HiTrap Q column at pH 8.0 for anion exchange chromatography

  • Perform final polishing using Superdex 75 size exclusion chromatography

This approach typically yields >95% pure protein with specific activity retention. For highest endonuclease activity, include 1 mM DTT in all buffers to maintain reduced cysteine residues, and avoid freeze-thaw cycles by storing aliquots at -80°C .

How do you verify the nuclease activity of recombinant LCL3?

Verification of LCL3 nuclease activity requires multiple complementary approaches:

  • Gel-based substrate degradation assay: Incubate purified LCL3 with different nucleic acid substrates (plasmid DNA, linear DNA, RNA) at various concentrations (5-100 ng/μL) and analyze degradation patterns by agarose gel electrophoresis .

  • Fluorescence-based assays: Use fluorescently labeled oligonucleotides with quenchers that release fluorescence upon cleavage. This allows real-time monitoring of enzymatic activity.

  • Radiolabeled substrate assays: For precise quantification, use 32P-labeled substrates and quantify product formation by phosphorimaging.

The reaction buffer composition significantly impacts activity. A typical reaction buffer contains:

  • 20 mM Tris-HCl (pH 7.5)

  • 50 mM NaCl

  • 5 mM MgCl2 (critical cofactor)

  • 1 mM DTT

Always include appropriate controls: heat-inactivated enzyme (95°C for 10 minutes), metal chelator controls (EDTA treatment), and substrate-only controls .

How does the substrate specificity of LCL3 compare to other fungal endonucleases?

LCL3 exhibits distinct substrate preferences compared to other characterized fungal endonucleases. While many fungal endonucleases show preferential cleavage of single-stranded nucleic acids, comparative analysis suggests LCL3 may have evolved specialized functions related to Verticillium pathogenicity .

Table 1: Comparative substrate specificity of fungal endonucleases

EndonucleaseOrganismssDNAdsDNARNASequence PreferenceMetal Cofactor
LCL3 (hypothetical)V. albo-atrum++++++G/C-rich regionsMg2+, Mn2+
VdENaseV. dahliae++++++Non-specificMg2+
NucAAspergillus++++++A/T-rich regionsCa2+
EndoG-likeFusarium+++++G/C-rich regionsMg2+

To characterize LCL3 substrate specificity:

  • Perform systematic comparisons using defined oligonucleotide substrates with varying sequences

  • Analyze cleavage kinetics using multiple substrate concentrations

  • Examine the impact of different divalent cations (Mg2+, Mn2+, Ca2+, Zn2+) on activity

  • Map cleavage sites using sequencing gels or high-resolution mass spectrometry

Understanding these preferences can provide insights into the biological role of LCL3 during host infection and potential biotechnological applications .

What experimental approaches can determine the role of LCL3 in Verticillium albo-atrum virulence?

The role of LCL3 in virulence requires a multi-faceted approach:

  • Gene deletion studies: Generate LCL3 knockout strains using Agrobacterium-mediated transformation or CRISPR-Cas9. Assess virulence in model plants (Arabidopsis, Nicotiana benthamiana) and agricultural hosts using standardized infection assays .

  • Complementation experiments: Reintroduce wild-type and mutant versions of LCL3 to confirm phenotypes and identify critical functional residues.

  • Spatiotemporal expression analysis: Use qRT-PCR and RNA-seq to determine when and where LCL3 is expressed during infection. Higher expression during specific infection stages suggests functional importance.

  • Protein localization: Generate GFP-tagged LCL3 constructs to visualize protein localization during host colonization using confocal microscopy.

  • Host immune response assessment: Measure plant defense responses (ROS burst, MAP kinase activation, defense gene expression) when exposed to purified LCL3 to determine if it functions as a PAMP (pathogen-associated molecular pattern) or effector .

When designing these experiments, randomize treatments, include appropriate controls (empty vector, non-pathogenic strains), and use multiple biological replicates (n ≥ 5 for plant assays) to ensure statistical robustness .

How do post-translational modifications affect LCL3 function?

Post-translational modifications (PTMs) can significantly impact LCL3 structure, stability, localization, and activity. As a secreted protein, LCL3 likely undergoes several PTMs that merit investigation :

  • N-linked glycosylation: Analyze potential glycosylation sites using algorithms like NetNGlyc and verify experimentally using glycosidase treatments and mass spectrometry. Glycosylation typically enhances protein stability and may shield antigenic epitopes from host recognition.

  • Disulfide bonds: LCL3 contains conserved cysteine residues that potentially form disulfide bonds critical for structural integrity. Validate these using non-reducing SDS-PAGE and mass spectrometry.

  • Proteolytic processing: Many fungal effectors require proteolytic activation. Determine if LCL3 undergoes N-terminal or internal processing by comparing native and recombinant forms using western blotting and N-terminal sequencing.

Table 2: Predicted PTMs for LCL3 and experimental validation methods

PTM TypePredicted SitesValidation MethodFunctional Significance
N-glycosylationAsn-X-Ser/Thr motifsPNGase F treatment, ConA bindingStability, host immune evasion
Disulfide bondsConserved Cys residuesNon-reducing SDS-PAGE, mass spectrometryStructural integrity
Proteolytic processingN-terminal signal peptideN-terminal sequencing, western blotActivation, localization
PhosphorylationSer/Thr/Tyr residuesPhospho-specific antibodies, mass spectrometryRegulation of activity

Generate site-directed mutants of each predicted modification site to assess their impact on protein function and stability in vitro and during infection .

What controls are essential when studying LCL3 function in vitro and in planta?

Robust experimental design for LCL3 studies requires comprehensive controls:

For in vitro biochemical assays:

  • Enzymatic activity controls:

    • Catalytically inactive mutant (e.g., mutation in the predicted active site)

    • Heat-denatured enzyme sample

    • Commercial DNase/RNase with known activity profiles

    • Buffer-only and substrate-only reactions

  • Substrate controls:

    • Methylated or otherwise protected substrates resistant to cleavage

    • Randomized sequence pools versus specific sequence substrates

    • Varying lengths and structures (linear, circular, single-stranded, double-stranded)

For in planta studies:

  • Genetic controls:

    • Empty vector transformants

    • Complemented knockout lines

    • Non-pathogenic strain transformants

  • Treatment controls:

    • Mock inoculations

    • Heat-killed spores

    • Treatment with purified inactive enzyme variants

  • Host plant controls:

    • Multiple independent transgenic lines

    • Different plant genotypes and ages

    • Different environmental conditions

Employ a randomized complete block design for plant experiments, with treatments randomized within each experimental block to minimize positional effects. Minimum recommended replication is 3 biological replicates with 3 technical replicates per biological sample .

How should researchers design experiments to distinguish between direct and indirect effects of LCL3?

Distinguishing direct from indirect effects of LCL3 requires careful experimental design:

  • Use catalytically inactive mutants: Generate point mutations in the predicted catalytic residues that abolish enzymatic activity but maintain protein folding. This helps determine if the observed phenotypes are due to enzymatic activity or protein-protein interactions.

  • Employ proximity labeling approaches: Techniques like BioID or APEX2 can identify proteins that physically interact with LCL3 in relevant biological contexts.

  • Implement temporal controls: Use inducible expression systems to activate LCL3 expression at specific timepoints, allowing observation of immediate versus delayed responses.

  • Apply pharmacological inhibitors: Use specific inhibitors of cellular processes to block potential downstream effects and identify direct targets.

  • Perform parallel -omics analysis: Compare transcriptomic, proteomic, and metabolomic responses to wild-type versus mutant LCL3 to map the cascade of effects.

For all approaches, time-course experiments are essential to establish causality. Early responses (minutes to hours) are more likely to represent direct effects, while later responses (hours to days) often reflect downstream cascades .

What statistical approaches are most appropriate for analyzing LCL3 functional data?

The choice of statistical approach depends on the experimental design and data characteristics:

  • For enzyme kinetics data:

    • Non-linear regression analysis for enzyme kinetics parameters (Km, Vmax)

    • Michaelis-Menten or allosteric models depending on substrate-velocity curves

    • Bootstrap resampling to establish confidence intervals for kinetic parameters

  • For comparative activity assays:

    • ANOVA with post-hoc tests (Tukey's HSD) for comparing activity across multiple conditions

    • Consider transformation of data if assumptions of normality are violated

    • Repeated measures designs when tracking activity over time

  • For in planta virulence studies:

    • Mixed-effects models that account for random effects (plant variability, experimental blocks)

    • Survival analysis (Kaplan-Meier) for disease progression data

    • Non-parametric tests (Mann-Whitney U) for disease severity scores

  • For -omics data integration:

    • Principal component analysis or hierarchical clustering to identify patterns

    • Gene set enrichment analysis for pathway-level effects

    • Network analysis to identify regulatory hubs affected by LCL3

Table 3: Recommended statistical approaches for different experimental designs

Data TypeStatistical ApproachSoftwareConsiderations
Enzyme kineticsNon-linear regressionGraphPad Prism, R (nls package)Test multiple models, report AIC values
Comparative activityANOVA, Tukey's HSDR (stats package), SPSSCheck assumptions, use Welch's correction if needed
Plant infection assaysMixed-effects modelsR (lme4 package)Include random effects for plant batch/genotype
Timecourse experimentsRepeated measures ANOVAR (nlme package)Account for temporal autocorrelation
High-throughput dataMultiple testing correctionR (multtest package)Control false discovery rate (Benjamini-Hochberg)

In all cases, conduct power analysis before experiments to determine appropriate sample sizes, and report effect sizes alongside p-values .

How do you resolve contradictory results between in vitro and in planta LCL3 studies?

Contradictions between in vitro and in planta studies are common and can arise from several factors:

  • Identify contextual differences:

    • In vitro conditions lack the complex cellular milieu, host factors, and regulatory networks

    • Protein concentrations in vitro often exceed physiological levels

    • Buffer compositions may not reflect in vivo ionic conditions

  • Reconciliation strategies:

    • Develop cell-free systems that better mimic in vivo conditions (plant cell extracts)

    • Perform dose-response studies to identify physiologically relevant concentrations

    • Use genetic approaches (complementation with mutant variants) to validate biochemical findings

  • Critical controls:

    • Test multiple substrate types and concentrations

    • Vary environmental conditions (pH, temperature, ion concentrations)

    • Include competition assays with potential natural substrates

When reporting contradictory results, present both datasets transparently and discuss potential biological explanations. Consider that both observations may be correct under their specific conditions, and the contradiction itself might reveal important regulatory mechanisms .

What approaches help differentiate the functions of LCL3 from other secreted proteins in Verticillium albo-atrum?

Differentiating LCL3 functions from other secreted proteins requires:

  • Comparative genomic analysis:

    • Identify structural homologs in related species

    • Determine if LCL3 is part of a gene family in V. albo-atrum

    • Compare with secretomes of mild versus lethal isolates

  • Transcriptomic profiling:

    • Map expression patterns during different infection stages

    • Compare expression across different host plants

    • Identify co-regulated genes that may function in the same pathway

  • Proteomic approaches:

    • Immunoprecipitation to identify interaction partners

    • Activity-based protein profiling to identify functional redundancy

    • Secretome analysis of wild-type versus LCL3 mutants to detect compensatory changes

  • Phenotyping strategy:

    • Generate single and combinatorial mutants of functionally related proteins

    • Employ tissue-specific or condition-specific promoters to restrict expression

    • Use protein domain swapping to identify functional regions

The secretome of V. albo-atrum contains numerous proteins with potential redundant or complementary functions, including multiple cell wall-degrading enzymes and effectors . Comprehensive approaches that combine these strategies provide the most robust differentiation of specific LCL3 functions.

How can researchers account for strain-specific variations when studying LCL3?

Strain-specific variations can substantially impact LCL3 studies and require careful consideration:

  • Genetic variation analysis:

    • Sequence LCL3 from multiple isolates to identify polymorphisms

    • Perform phylogenetic analysis to relate sequence variations to strain virulence

    • Use site-directed mutagenesis to test the functional impact of natural variants

  • Expression variation assessment:

    • Compare expression levels between mild and lethal isolates

    • Identify potential regulatory elements in promoter regions

    • Characterize epigenetic modifications that might affect expression

  • Functional comparison strategies:

    • Express and purify LCL3 from multiple strains for side-by-side activity testing

    • Generate chimeric proteins to map functional regions

    • Develop a panel of reporter strains to standardize phenotypic assays

  • Experimental design considerations:

    • Always specify the strain background in publications

    • Include multiple reference strains when possible

    • Generate isogenic lines where the only difference is the LCL3 variant

Table 4: Comparison of LCL3 characteristics across Verticillium albo-atrum isolates

IsolateGeographic OriginVirulence LevelLCL3 Expression*Activity Level*Notable Sequence Variations
Strain AUnited KingdomMild+++N45S, T120A
Strain BGermanyLethal+++++++Wild-type
Strain CSloveniaLethal+++++K78R
Strain DUnited StatesMild++5' UTR variation, reduced expression

*Relative levels indicated by + (low) to ++++ (very high)

This table represents hypothetical data based on the patterns observed in comparisons of mild and lethal isolates of V. albo-atrum mentioned in the research .

What emerging technologies could advance our understanding of LCL3 function?

Several cutting-edge technologies hold promise for deepening our understanding of LCL3:

  • CRISPR-Cas9 genome editing: Beyond simple knockouts, CRISPR technologies enable precise editing to generate point mutations, domain deletions, and tagged proteins in the native genomic context. This facilitates studying LCL3 under native regulatory control.

  • Single-cell transcriptomics: Analyzing gene expression at the single-cell level during infection can reveal population heterogeneity and identify specific plant cell types targeted by LCL3.

  • Cryo-electron microscopy: Determining the high-resolution structure of LCL3 can provide insights into its catalytic mechanism and substrate specificity. This information can guide rational design of mutations for functional studies.

  • Spatial transcriptomics/proteomics: These techniques can map where and when LCL3 is expressed or localized during infection, providing spatial context to functional studies.

  • Nanopore direct RNA sequencing: This technology can identify specific RNA modifications induced by LCL3, potentially revealing novel substrate preferences not apparent in conventional assays.

  • Protein-protein interaction networks: Techniques like BioID, APEX proximity labeling, or protein correlation profiling can identify the interactome of LCL3 during infection, revealing potential partners and targets .

  • Live-cell imaging with biosensors: Developing specific activity biosensors can allow real-time visualization of LCL3 activity in living cells, providing temporal and spatial resolution of function.

These technologies, especially when used in combination, can provide unprecedented insights into the biological roles of LCL3 in Verticillium pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.