Recombinant Vesicomyosocius okutanii subsp. Calyptogena okutanii ATP synthase subunit b (atpF)

What is Vesicomyosocius okutanii and why is it scientifically significant?

Vesicomyosocius okutanii (abbreviated as Ca. Vesicomyosocius okutanii) is an intracellular obligate symbiont of deep-sea Calyptogena clams. This sulfur-oxidizing gammaproteobacterium has significant scientific importance as it represents a model system for studying host-symbiont coevolution and metabolic adaptation in extreme environments. The organism has a reduced genome (1.02 Mb) with low G+C content (31.6%), indicating it is in an ongoing stage of reductive genome evolution . The symbiont provides organic carbon to its host through chemosynthesis, utilizing energy generated from sulfur oxidation, which makes it crucial for the survival of these deep-sea clams .

What is the function of ATP synthase subunit b (atpF) in V. okutanii?

ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex in V. okutanii. The protein functions as part of the peripheral stalk (subunits b₂δ) that connects the F₁ catalytic domain to the F₀ membrane domain. This structural arrangement is essential for:

• Maintaining the structural integrity of the ATP synthase complex

• Preventing rotation of the α₃β₃ catalytic head during ATP synthesis

• Facilitating the transmission of energy between the F₁ and F₀ regions

The amino acid sequence of the atpF protein is: MNINLTMFGQLIMFAMFTWFCMKFIWPPIVMAMEERQKRIEGGLLAAERGRFEKAEAQIKAKEIINQSKSLAAEIIANATRQALNMVEDAKYIALKEAGKVKEQAQAQLEQDTICVRNELKNQVSDLVIQGVNAVLDKEVDVKLHQQMLGKLSESLS .

How does the ATP synthase complex function in this symbiotic bacterium?

In V. okutanii, the ATP synthase operates similarly to other F-type ATPases but with adaptations specific to its symbiotic lifestyle. The enzyme catalyzes ATP synthesis using the energy from a transmembrane proton gradient established during sulfur oxidation . The ATP synthase complex consists of two major domains:

• The F₁ sector: Contains the catalytic sites for ATP synthesis

• The F₀ sector: Embedded in the membrane and responsible for proton translocation

The rotation of the c-ring in the F₀ sector drives the rotation of the γ-subunit in the F₁ sector, causing conformational changes in the catalytic β-subunits that lead to ATP synthesis. The process follows the equation:
ADP + Pᵢ → ATP

This energy production is particularly crucial in the symbiotic relationship, as ATP generated by V. okutanii fuels carbon fixation pathways that ultimately provide organic carbon to the host clam .

What methods can be used to produce recombinant V. okutanii ATP synthase subunit b?

The recombinant production of V. okutanii ATP synthase subunit b (atpF) can be achieved using an E. coli expression system, following a methodology similar to that used for other membrane proteins:

• Gene synthesis and vector construction:

  • Synthesize the atpF gene with codon optimization for E. coli expression

  • Clone into an appropriate expression vector (e.g., pMAL-c2x for MBP fusion strategy)

• Expression strategies:

  • Express as a fusion protein with a solubility tag (e.g., MBP, His-tag)

  • Transform into an appropriate E. coli strain (e.g., T7 Express lysY/Iq)

  • Consider co-expression with chaperone proteins (DnaK, DnaJ, and GrpE) using vectors like pOFXT7KJE3 to improve protein folding and yield

• Optimization of expression conditions:

  • Test various induction temperatures (typically 18-30°C)

  • Vary IPTG concentrations (typically 0.1-1.0 mM)

  • Optimize induction time (typically 4-24 hours)

• Purification approach:

  • Use affinity chromatography based on the fusion tag

  • Consider on-column cleavage of the fusion tag

  • Perform size exclusion chromatography to obtain pure protein

This approach has been successful for similar proteins such as chloroplast ATP synthase c₁ subunit .

What challenges are associated with the expression and purification of recombinant V. okutanii atpF?

Recombinant expression of V. okutanii atpF presents several challenges that researchers must address:

• Membrane protein solubility issues:

  • The hydrophobic nature of atpF can lead to aggregation and inclusion body formation

  • Solution: Expression as a fusion protein with solubility enhancers like MBP or SUMO

• Protein toxicity to host cells:

  • Overexpression may be toxic to E. coli

  • Solution: Use tightly regulated expression systems and specialized host strains (e.g., T7 Express lysY/Iq)

• Proper folding:

  • Membrane proteins often misfold in heterologous systems

  • Solution: Co-express with chaperone proteins (DnaK, DnaJ, GrpE) using vectors like pOFXT7KJE3

• Maintaining stability during purification:

  • The protein may denature during extraction and purification

  • Solution: Use optimal buffer conditions with stabilizing agents like glycerol (typically 50%) and store at -20°C or -80°C

• Verification of correct structure:

  • Ensuring the recombinant protein adopts its native conformation

  • Solution: Use circular dichroism spectroscopy to confirm alpha-helical secondary structure

How can researchers validate the structural integrity of purified recombinant atpF protein?

Validation of recombinant atpF structural integrity requires multiple complementary approaches:

• SDS-PAGE and Western blotting:

  • Confirm protein size and purity

  • Use anti-ATP synthase antibodies for detection

• Secondary structure analysis:

  • Circular dichroism (CD) spectroscopy to confirm alpha-helical content

  • Fourier-transform infrared spectroscopy (FTIR) for additional structural information

• Functional validation:

  • ATP hydrolysis assay to confirm enzymatic activity when assembled in the complex

  • Proton translocation assays using reconstituted proteoliposomes

• Thermal stability analysis:

  • Differential scanning calorimetry (DSC) or thermal shift assays

  • Provides information on protein folding and stability

• Mass spectrometry analysis:

  • Confirm the exact mass and sequence coverage

  • Identify any post-translational modifications

These methods collectively ensure that the recombinant protein resembles its native counterpart in both structure and function.

How can quasi-experimental designs be applied to study the function of recombinant V. okutanii atpF?

Quasi-experimental designs can be valuable for studying recombinant V. okutanii atpF when randomized controlled trials are not feasible. Based on the hierarchy described by Shadish et al. , the following approaches can be applied:

• Interrupted time-series design with removal:

  • Measure ATP synthase activity (O₁) before introducing recombinant atpF

  • Introduce recombinant atpF and measure activity again (O₂ and O₃)

  • Remove recombinant atpF and take final measurement (O₄)

  • This allows testing of hypotheses about the outcome in both presence and absence of the intervention

• Multiple baseline design:

  • Introduce recombinant atpF to different experimental systems at different times

  • Observe whether changes in ATP synthase activity coincide with introduction of recombinant atpF

  • This controls for maturation and history effects

• Nonequivalent dependent variables design:

  • Measure both variables expected to change (ATP synthesis rate) and variables not expected to change (other metabolic processes)

  • Changes only in expected variables strengthen causal inference

When using these designs, researchers must address potential threats to validity as outlined in this table:

What can we learn about ATP synthase evolution from studying V. okutanii atpF?

Studying V. okutanii atpF provides unique insights into ATP synthase evolution in the context of symbiosis and reductive genome evolution:

• Genome reduction and gene conservation:

  • Unlike some DNA repair genes that have been lost (recA, mutY) , the atpF gene has been conserved in the V. okutanii genome

  • This conservation highlights the essential nature of ATP synthesis even in highly streamlined genomes

  • Comparative analysis with other symbionts could reveal selection pressures on ATP synthase components

• Functional adaptations to symbiosis:

  • Analysis of sequence variations in atpF between free-living relatives and obligate symbionts

  • Identification of positively selected residues that may reflect adaptation to the host environment

  • Potential insights into how ATP production is optimized for the symbiotic lifestyle

• Stoichiometric variation in ATP synthase components:

  • Similar to investigations of c-subunit stoichiometry in chloroplast ATP synthase

  • The ratio of protons translocated to ATP synthesized depends on the number of c-subunits per oligomeric ring

  • This ratio affects the energetic efficiency of ATP production and may be adapted to the specific metabolic requirements of symbiosis

• Structural adaptations:

  • Comparison of atpF structure with homologs from other bacteria, mitochondria, and chloroplasts

  • Insights into how the peripheral stalk architecture has evolved across different lineages

  • Understanding of structural flexibility that enables power transmission between F₁ and F₀ regions with different symmetries

How does gene expression of atpF in V. okutanii relate to the symbiotic relationship with its host?

The expression of atpF in V. okutanii is intricately linked to its symbiotic relationship with Calyptogena clams:

• Transcriptomic evidence:

  • ATP synthase genes, including F-type ATPase, are among the highly expressed genes in the endosymbionts

  • These genes work together with other energy-generating pathways such as sulfide oxidation (dsrABCL gene complex, aprA gene)

  • The high expression levels indicate the critical role of ATP production in fueling carbon fixation for the host

• Co-expression patterns:

  • ATP synthase genes are co-expressed with genes involved in oxidative phosphorylation and carbon fixation

  • This coordinated expression ensures efficient energy production and nutritional support for the host

  • Glutamine synthase and glutamate synthase are also highly expressed, suggesting important roles in amino acid biosynthesis

• Host-symbiont metabolic integration:

  • The host TCA cycle genes (aconitate hydratase-like, 2-oxoglutarate dehydrogenase, isocitrate dehydrogenase, succinate ligase) are highly expressed in gill tissues containing symbionts

  • This suggests metabolic complementation between host and symbiont

  • ATP production by the symbiont may support both symbiont and host metabolic processes

• Regulation mechanisms:

  • The regulation of atpF expression likely responds to environmental cues such as sulfide availability

  • Host factors may also influence symbiont gene expression through currently unknown signaling mechanisms

  • Understanding these regulatory relationships could provide insights into host-symbiont communication

What strategies can improve yield and solubility of recombinant V. okutanii atpF?

Improving yield and solubility of recombinant V. okutanii atpF requires multiple optimization strategies:

• Fusion protein approach:

  • Express as a fusion with solubility-enhancing partners like MBP or SUMO

  • The MBP fusion approach has been successful for similar membrane proteins

  • Example construct design: pMAL-c2x-malE/atpF for expression of MBP-atpF fusion protein

• Codon optimization:

  • Optimize the atpF coding sequence for E. coli expression

  • Adjust rare codons to match E. coli codon usage preferences

  • This can significantly improve translation efficiency and protein yield

• Chaperone co-expression:

  • Co-transform expression host with pOFXT7KJE3 vector expressing DnaK, DnaJ, and GrpE chaperones

  • Chaperones can substantially increase quantities of recombinant proteins that are toxic or difficult to produce

• Expression condition optimization:

  • Lower induction temperature (16-20°C) to slow protein synthesis and improve folding

  • Reduce IPTG concentration (0.1-0.5 mM) for gentler induction

  • Extended expression time (overnight to 24h) at lower temperatures

• Buffer optimization:

  • Include stabilizing agents like glycerol (up to 50%) in purification buffers

  • Test different detergents for membrane protein extraction and stabilization

  • Optimize pH and salt concentration based on protein properties

These approaches can be systematically tested using a factorial experimental design to identify optimal conditions.

How can researchers design experiments to study the interactions between recombinant atpF and other ATP synthase subunits?

Studying interactions between recombinant atpF and other ATP synthase subunits requires careful experimental design:

• Co-expression systems:

  • Design constructs for co-expression of atpF with interacting partners (e.g., δ-subunit)

  • Use dual expression vectors or co-transformation approaches

  • Include different affinity tags on each protein for sequential purification

• In vitro reconstitution experiments:

  • Purify individual subunits separately

  • Mix purified components under controlled conditions

  • Monitor complex formation using size exclusion chromatography or native PAGE

• Protein-protein interaction assays:

  • Pull-down assays using immobilized recombinant atpF

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters of binding

• Crosslinking studies:

  • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Site-specific crosslinking using unnatural amino acids

  • This can identify specific residues involved in subunit interactions

• Structural biology approaches:

  • Cryo-EM analysis of reconstituted complexes

  • X-ray crystallography of co-crystallized components

  • NMR studies of labeled proteins to identify interaction interfaces

These methods should be combined to build a comprehensive understanding of how atpF interacts with other ATP synthase components.

What are the critical considerations for experimental controls when studying recombinant V. okutanii atpF?

Rigorous experimental controls are essential when studying recombinant V. okutanii atpF:

• Expression controls:

  • Negative control: Expression vector without atpF insert (e.g., pMAL-c2x with no atpF)

  • Positive control: Well-characterized membrane protein expressed under identical conditions

  • These controls help distinguish issues with the expression system from protein-specific challenges

• Purification controls:

  • Column matrix without immobilized protein/antibody

  • Elution fractions from non-transformed cells processed identically

  • These help identify non-specific binding and contaminants

• Functional assays:

  • Heat-denatured protein as negative control

  • Known ATP synthase inhibitors (e.g., oligomycin) as specificity controls

  • Well-characterized ATP synthase from another source as positive control

• Structural integrity:

  • Circular dichroism spectra of properly folded versus denatured protein

  • Compare with predicted secondary structure based on homology models

  • Monitor stability over time under various storage conditions

• For quasi-experimental designs:

  • Include "untreated" control groups where possible

  • Use time-series measurements to establish baselines

  • Consider the threats to validity outlined by Shadish et al. and implement appropriate controls for each

How might recombinant V. okutanii atpF be used to study the c-ring stoichiometry and proton/ATP ratio?

Recombinant V. okutanii atpF could be instrumental in investigating c-ring stoichiometry and proton/ATP ratio through these approaches:

• Reconstitution experiments:

  • Use recombinant atpF along with other ATP synthase components to reconstitute functional complexes

  • Similar approaches with spinach chloroplast ATP synthase have revealed insights into c-ring assembly

  • The stoichiometry of c-subunits affects the proton/ATP ratio, which is organism-dependent

• Structural analysis of reconstituted complexes:

  • Cryo-EM analysis of reconstituted ATP synthase containing recombinant atpF

  • Direct visualization and counting of c-subunits in the oligomeric ring

  • Comparison with native complexes to confirm structural fidelity

• Functional measurements:

  • Proton flux measurements in reconstituted proteoliposomes

  • ATP synthesis assays under controlled proton gradient conditions

  • Calculate the H⁺/ATP ratio from the measured proton flux and ATP synthesis rates

• Mutagenesis studies:

  • Introduce mutations in atpF to study its role in stabilizing the c-ring

  • Identify residues that influence c-ring assembly and stoichiometry

  • This builds on research showing that "the ratio of protons translocated to ATP synthesized varies according to the number of c-subunits (n) per oligomeric ring (cn) in the enzyme, which is organism dependent"

• Comparative analysis with other extremophiles:

  • Compare V. okutanii ATP synthase with those from other extremophiles

  • Identify adaptations that optimize energy conversion in different environments

  • Understand how the proton/ATP ratio relates to metabolic efficiency in symbiotic systems

What insights could be gained by comparing ATP synthase components across different chemosynthetic symbionts?

Comparative analysis of ATP synthase components across chemosynthetic symbionts could reveal:

• Evolutionary adaptations to symbiosis:

  • Identify convergent or divergent adaptations in ATP synthase components

  • Compare V. okutanii with other symbionts like those from Bathymodiolus mussels

  • Sequence analysis could reveal positively selected sites related to host adaptation

• Energetic efficiency variations:

  • Differences in c-ring stoichiometry affecting H⁺/ATP ratios

  • Adaptations that optimize ATP production based on available energy sources

  • Relationship between ATP synthase efficiency and host metabolic requirements

• Genome reduction patterns:

  • Conservation patterns of ATP synthase genes during reductive evolution

  • Similar to studies of DNA repair genes showing clade-specific gene loss patterns

  • Insights into which ATP synthase components are essential versus dispensable

• Expression regulation:

  • Comparative transcriptomics to identify differential expression patterns

  • Similar to studies showing that dsrABCL, aprA, and ATP synthase genes are among the highest expressed in V. okutanii

  • Relationship between expression patterns and symbiotic efficiency

• Structural adaptations:

  • Comparative structural analysis of ATP synthase components

  • Identification of unique features that may reflect adaptation to specific hosts or environments

  • Insights into structure-function relationships in symbiotic contexts

This comparative approach could significantly advance our understanding of how energy production mechanisms adapt to symbiotic lifestyles.

How can understanding V. okutanii ATP synthase contribute to biotechnological applications?

Understanding V. okutanii ATP synthase has several potential biotechnological applications:

• Bioenergy applications:

  • Insights into efficient energy conversion in extreme environments

  • Development of bio-inspired energy conversion systems

  • Engineering of ATP synthases with optimized proton/ATP ratios for biotechnological applications

• Protein engineering platforms:

  • Using recombinant expression systems developed for V. okutanii atpF as platforms for other challenging membrane proteins

  • Application of fusion protein strategies to other difficult-to-express proteins

  • Development of improved chaperone co-expression systems

• Bionanotechnology:

  • ATP synthase as a molecular motor for nanoscale devices

  • Adaptation of the c-ring rotation mechanism for engineered nanomachines

  • Insights from extremophile ATP synthases could improve stability of such devices

• Drug discovery:

  • ATP synthase as a potential antimicrobial target

  • Structural insights that could inform selective inhibitor design

  • Development of screening assays using recombinant components

• Synthetic biology applications:

  • Engineering minimal ATP synthesis modules for synthetic cells

  • Integration of chemosynthetic energy production into engineered systems

  • Development of artificial symbiotic relationships based on energy transfer principles

These applications represent the potential translation of basic research on V. okutanii ATP synthase into biotechnological innovations.