Recombinant Vesicular stomatitis Indiana virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vesicular Stomatitis Indiana Virus Glycoprotein G (G)

Recombinant Vesicular Stomatitis Indiana Virus Glycoprotein G (G) refers to a modified form of the glycoprotein G derived from the Indiana serotype of the Vesicular Stomatitis Virus (VSIV) . VSIV is a virus that causes vesicular disease in livestock . Glycoprotein G is a surface protein of VSIV responsible for the virus's attachment to host cells and mediation of membrane fusion, which are crucial steps for viral entry and infection .

The "recombinant" aspect indicates that the glycoprotein G gene has been manipulated using genetic engineering techniques . These modifications can involve inserting the G gene into a different viral vector or host organism for expression and production . Recombinant VSIV-G is utilized in vaccine development and research due to its ability to elicit an immune response .

Structure and Function

Glycoprotein G, a key component of the Vesicular Stomatitis Virus (VSIV), plays a pivotal role in the virus's infectious cycle . Its primary functions include attaching the virus to host cell receptors and facilitating the fusion of the viral and cellular membranes .

Key Structural and Functional Aspects:

  • Attachment and Entry: Glycoprotein G facilitates the virus's attachment to host cellular receptors, initiating the endocytosis of the virion .

  • Membrane Fusion: Within the endosome, the acidic pH triggers conformational changes in the glycoprotein trimer, leading to the fusion of the virus and cell membrane .

  • Fusion Loops: Hydrophobic fusion loops within G are critical for membrane fusion . Altering the hydrophobicity of these loops can produce nonfusogenic mutants .

Production and Characterization

Recombinant Glycoprotein G can be produced in various expression systems, each offering unique advantages.

Expression Systems:

  • E. coli: Recombinant Glycoprotein G is often expressed in E. coli . The protein produced in E. coli can be used in ELISA, WB, and IP .

  • Purification: The recombinant protein is typically purified to high purity, often exceeding 90%, as determined by SDS-PAGE .

  • Biological Activity: The biological activity of recombinant Glycoprotein G is often assessed by its binding ability in functional ELISA assays .

Applications in Vaccine Development

Recombinant VSIV-G has emerged as a promising tool in vaccine development, particularly for its ability to induce neutralizing antibodies and provide protection against viral challenges .

Vaccine studies:

  • VSIV-GNJGI: Expressed both glycoproteins stably through multiple rounds of replication in swine and induced neutralizing antibodies against both VSV serotypes .

  • Homologous Challenge Protection: Immunization with VSIV-GI or VSIV-GNJ protects against homologous high dose virus challenge .

  • Filovirus Vaccines: Recombinant Vesicular Stomatitis Virus is used to develop vaccines against Marburg virus and other filoviruses .

Research Findings

Recombinant VSIV-G has been extensively used in research to understand the mechanisms of viral entry, membrane fusion, and pathogenesis .

Key Research Areas:

  • Determinant of Pathogenicity: The glycoprotein is a determinant of VSV virulence in natural hosts .

  • Virus Replication: VSV pathology in swine correlates primarily with virus replication .

  • Fusion Mechanism: Studies using recombinant viruses with lethal mutations in G have confirmed the importance of hydrophobic fusion loops in membrane fusion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-511
Protein Length
Full Length of Mature Protein
Species
Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)
Target Names
G
Target Protein Sequence
KFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTAIQVKMPKSHKAIQADGWMCH ASKWVTTCDFRWYGPKYITQSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVT DAEAVIVQVTPHHVLVDEYTGEWVDSQFINGKCSNYICPTVHNSTTWHSDYKVKGLCDSN LISMDITFFSEDGELSSLGKEGTGFRSNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMA DKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPV DLSYLAPKNPGTGPAFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERELWDDW APYEDVEIGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDD ESLFFGDTGLSKNPIELVEGWFSSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTK KRQIYTDIEMNRLGK
Uniprot No.

Target Background

Function
Vesicular stomatitis virus glycoprotein G (VSV-G) mediates viral entry by binding to host LDL receptors, triggering clathrin-dependent endocytosis. The ensuing acidic pH within the endosome induces conformational changes in the glycoprotein trimer, leading to fusion between the viral and endosomal membranes.
Gene References Into Functions

References:

  1. Vesicular stomatitis virus G protein complex with two distinct cysteine-rich domains (CR2 and CR3) of LDL-R. PMID: 29531262
  2. Analysis of glycoprotein G structural changes suggests that G monomers can re-associate into dimers that play a role in early fusion stages. PMID: 28188244
  3. NSF deficiency in HeLa cells showed minimal impact on cell viability, anterograde trafficking of VSV-G, and transferrin endocytosis. PMID: 27995606
  4. MARCH8, highly expressed in differentiated myeloid cells, is an antiviral protein targeting viral envelope glycoproteins and reducing their incorporation into virions. PMID: 26523972
  5. Pepscan mapping identified autophagy-inducing peptides within the fusion domains of VSV-G and viral hemorrhagic septicemia virus glycoproteins. PMID: 25046110
  6. Functional substitution of the HIV Env membrane-proximal external region for the VSV-G stem region suggests similar functional roles despite originating from unrelated viruses. PMID: 24597516
  7. Residue D268 is identified as the major pH sensor in VSV-G, with additional contributions from D274, D395, and D393. PMID: 25210175
  8. Recombinant VSV with RABV-G exhibits strong transgene expression and rapid retrograde neuronal spread. PMID: 23403489
  9. Energetic analyses reveal weakened interaction between Domain IV and the protein core at pH 5, attributed to differentially protonated residues at the interface. PMID: 22806964
  10. Studies using lethal mutations in VSV-G confirm the critical role of hydrophobic fusion loops in membrane fusion, highlighting the importance of surrounding sequence elements. PMID: 21680501
  11. BMP preferentially affects VSV-G's ability to mediate lipid mixing during membrane fusion. PMID: 21333650
  12. VSIV-6.8 adaptation to pH 6.6 and 6.4 resulted in amino acid substitutions in regions not previously linked to attachment or fusion. PMID: 15731252
  13. Crystal structure analysis reveals the classic hairpin conformation in the low-pH form of G, consistent with other fusion proteins. PMID: 16840692
  14. The prefusion form structure, determined at 3.0 angstrom resolution, shows extensive structural reorganization during the fusogenic transition. PMID: 17289996
  15. VSV-G is essential for inducing a CD14/TLR4-dependent response. PMID: 17292937
  16. A model of virus assembly is proposed where VSV nucleocapsid interaction with G-protein microdomains precedes viral budding site formation. PMID: 18367537
Database Links

KEGG: vg:1489834

Protein Families
Vesiculovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein. Note=The cytoplasmic domain sorts the protein to neurons dentrites instead of axons. When expressed in ex vivo polarized cells like epithelial cells, it sorts the protein to the basolateral side.

Q&A

What is the Vesicular Stomatitis Indiana Virus (VSIV) glycoprotein G and why is it significant in viral research?

The VSIV glycoprotein G (G protein) is the sole surface protein of VSV that mediates viral attachment and entry into host cells. It consists of 511 amino acids and is glycosylated at positions 178 and 335, with covalently linked fatty acid in its cytoplasmic domain . Its significance stems from several key characteristics:

  • Functions as the primary mediator of virus attachment to cellular LDL receptors (LDLR) or LDLR family members

  • Facilitates fusion of the viral envelope with endosomal membranes after endocytosis

  • Acts as the primary target for neutralizing antibodies

  • Serves as a determinant of viral pathogenesis in natural hosts

  • Provides a versatile platform for engineering recombinant viruses for vaccine development, oncolytic virotherapy, and gene delivery

The VSIV G protein differs from its New Jersey serotype counterpart (VSNJV G) in several aspects, including amino acid length (511 versus 517), acylation status (VSIV G is acylated while VSNJV G is not), and antigenic properties, despite sharing identical glycosylation sites .

How does the structure of VSIV glycoprotein G compare to other viral glycoproteins?

VSIV glycoprotein G possesses several distinctive structural features that differentiate it from other viral glycoproteins:

  • Contains a trimeric organization in its native state on the virion surface

  • Features two conserved N-linked glycosylation sites (positions 178 and 335)

  • Includes a cytoplasmic domain that can be modified (truncated from 29 to 9 or 1 amino acid) to attenuate virus pathogenicity

  • Possesses a transmembrane domain that can be used in chimeric constructs to anchor foreign proteins to the viral membrane

Unlike many other viral fusion proteins, VSV G mediates fusion through a pH-dependent mechanism that allows it to undergo reversible conformational changes, making it particularly useful for laboratory applications .

How can researchers assess the stability and expression of recombinant glycoproteins in VSV vectors?

Researchers can employ several complementary approaches to assess the stability and expression of recombinant glycoproteins in VSV vectors:

Protein expression analysis:

  • Western blotting to confirm glycoprotein expression and determine relative quantities

  • Flow cytometry to analyze surface expression on infected cells

  • Immunofluorescence microscopy to visualize localization

  • Electron microscopy to confirm incorporation into virions

Functional stability assessment:

  • Serial passage experiments through multiple generations (typically 5-10 passages)

  • Sequencing of the glycoprotein gene after multiple passages to detect mutations

  • Neutralization assays using serotype-specific antibodies to confirm antigenic integrity

A comprehensive example from Martinez et al. demonstrated that VSIV-GNJGI "expressed both glycoproteins stably through multiple rounds of replication in swine and induced neutralizing antibodies against both VSV serotypes" , confirming the stability of this recombinant construct in vivo.

What neutralizing antibody responses are generated against different recombinant VSV glycoprotein constructs?

Neutralizing antibody responses against recombinant VSV glycoprotein constructs show specific patterns that depend on the glycoprotein(s) expressed:

Serotype-specific responses:

  • VSIV-GI (expressing Indiana serotype glycoprotein) induces neutralizing antibodies specific to the Indiana serotype

  • VSIV-GNJ (expressing New Jersey serotype glycoprotein) induces neutralizing antibodies specific to the New Jersey serotype

  • VSNJV (natural New Jersey field isolate) generates neutralizing antibodies specific to the New Jersey serotype

Bivalent responses:

  • VSIV-GNJGI (expressing both serotype glycoproteins) induces neutralizing antibodies against both VSV serotypes, with a notable dominance of the Indiana serotype response

This differential antibody response has significant implications for vaccine design, as summarized in the following table:

Recombinant VirusGlycoprotein(s) ExpressedNeutralizing Antibody ResponseProtection Against Challenge
VSIV-GIIndiana serotype (GI)Indiana-specificComplete against VSIV-GI
VSIV-GNJNew Jersey serotype (GNJ)New Jersey-specificComplete against homologous challenge
VSIV-GNJGIBoth Indiana and New Jersey (GI and GNJ)Both serotypes (Indiana dominant)Complete against VSIV-GI; partial against pathogenic VSNJV field isolate

These findings demonstrate that glycoprotein expression directly determines the serological response and protective efficacy of recombinant VSV vaccines .

What factors influence the efficacy of recombinant VSV glycoprotein G-based vaccines?

Multiple factors influence the efficacy of recombinant VSV glycoprotein G-based vaccines, with implications for research design and clinical applications:

Vector design factors:

  • Glycoprotein expression levels (ranging from 23-62% of native VSV G levels)

  • Position of the foreign gene in the VSV genome (affecting transcription levels due to the sequential nature of VSV gene expression)

  • Stability of the foreign glycoprotein through multiple replication cycles

  • Retention vs. replacement of native VSV G (affecting vector tropism and safety profile)

Host response factors:

  • Pre-existing immunity to the vector (generally low for VSV in human populations)

  • Host species differences (critical, as demonstrated by opposite pathogenicity patterns in mice vs. swine)

  • Route of administration (intranasal, intramuscular, etc.)

  • Dosage (typical effective doses range from 10^4 to 10^7 PFU)

Safety considerations:

  • Attenuation strategies, including G cytoplasmic domain truncation

  • Complete G deletion and replacement approaches

  • Neurovirulence assessment, particularly important given VSV's neurotropism in some animal models

Research by Rodriguez et al. demonstrated that pigs immunized with VSIV-GI or VSIV-GNJ were completely protected against homologous high-dose virus challenge, while pigs inoculated with VSIV-GNJGI were protected against challenge with VSIV-GI but showed partial protection against highly pathogenic New Jersey field isolate challenge .

How can researchers leverage VSV glycoprotein G for studying heterologous viral entry mechanisms?

Researchers can use VSV glycoprotein G as a powerful tool for studying viral entry mechanisms through several sophisticated approaches:

Pseudotyping systems:
The VSV glycoprotein can be replaced with glycoproteins from different viral families to study their entry mechanisms in a controlled background. This has been successfully implemented with:

  • Filovirus glycoproteins (Ebola and Marburg viruses)

  • Coronavirus spike proteins

  • Arenavirus and hantavirus glycoproteins

This approach allows researchers to study high-containment pathogens under lower biosafety conditions and isolate entry steps from other aspects of the viral life cycle.

Structure-function analysis:
Targeted mutations in foreign glycoproteins expressed in the VSV background can help elucidate:

  • Receptor binding domains

  • Fusion peptides

  • Conformational changes required for membrane fusion

  • Host range determinants

As noted in recent research: "The methods described herein can facilitate the study of both native and recombinant VSV encoding foreign glycoproteins and can serve as the basis for the production of VSV-based vaccines" .

Comparative virology applications:
The VSV system enables direct comparison of entry efficiency between different viral glycoproteins by:

  • Generating multiple recombinant VSVs with different glycoproteins

  • Standardizing viral titers

  • Comparing infection rates across different cell types

  • Identifying cellular factors that restrict or enhance entry

What are the methodological challenges in engineering VSV glycoprotein G for optimized oncolytic virotherapy?

Engineering VSV glycoprotein G for oncolytic virotherapy presents several methodological challenges that researchers must address:

Balancing targeting and replication efficiency:

  • Modification of VSV G to target tumor-specific receptors can reduce natural tropism

  • Maintaining sufficient viral entry into cancer cells while reducing normal tissue infectivity

  • Preserving fusion functionality when altering receptor binding domains

Immunological considerations:

  • Rapid neutralization of the virus by host antibodies may limit therapeutic efficacy

  • Pre-existing immunity against VSV is generally low in human populations, allowing for effective initial treatment

  • Repeated administration challenges require strategies to evade or delay neutralizing antibody responses

Safety engineering approaches:

  • Attenuating VSV by truncating the G cytoplasmic domain (from 29 to 9 or 1 amino acid)

  • Creating conditional replication systems that respond to cancer-specific factors

  • Incorporating additional safety features such as microRNA target sequences or drug-controllable elements

Production and stability challenges:

  • Maintaining genetic stability of modified G proteins through multiple rounds of replication

  • Ensuring consistent incorporation of engineered glycoproteins into virions

  • Optimizing production methods for clinical-grade material

As noted in research on VSV as an oncolytic platform: "Overcoming immunological challenges to aid repeated administration of viral vectors and minimizing harmful host–vector interactions remains one of the major challenges. In the future, exploitation of reverse genetic tools may assist the creation of recombinant viral variants that have improved onco-selectivity" .

What methodological approaches can resolve discrepancies between in vitro and in vivo findings when studying VSV glycoprotein G variants?

Resolving discrepancies between in vitro and in vivo findings for VSV glycoprotein G variants requires multi-faceted methodological approaches:

This dichotomy necessitates:

  • Testing in multiple animal models with comparative analysis

  • Using primary cells derived from relevant host species rather than established cell lines alone

  • Developing ex vivo tissue systems that better mimic in vivo conditions

Mechanistic investigations:

  • Receptor distribution and density analysis across different tissues and species

  • Evaluation of innate immune responses that may differ between models

  • Assessment of tissue-specific factors affecting viral entry and replication

Standardized comparative parameters:
When comparing in vitro and in vivo systems, standardize measurements of:

  • Viral replication kinetics

  • Gene expression patterns

  • Cytopathic effects

  • Immune response activation

Integration of complementary techniques:

  • In vivo imaging to track virus distribution and replication non-invasively

  • Transcriptomic and proteomic analysis of host responses

  • Single-cell analysis to identify differential cellular susceptibility

  • Computational modeling to integrate diverse datasets

These approaches can help researchers understand why "the G glycoprotein was involved in the differential pathogenesis of VSIV and VSNJV in swine" despite showing opposite trends in mice, emphasizing that "the molecular determinants of VSV pathogenesis in natural hosts remain undefined" .

What emerging technologies could enhance the utility of recombinant VSV glycoprotein G in vaccine and therapeutic development?

Several emerging technologies hold promise for enhancing the utility of recombinant VSV glycoprotein G in vaccine and therapeutic development:

Synthetic virology approaches:
Recent advances in synthetic biology have enabled more efficient construction of VSV genomes: "The 11,161 base pair synthetic VSV (synVSV) was assembled from four modularized DNA fragments. Following rescue and titration, phenotypic analysis showed no significant differences between natural and synthetic viruses" . This modular approach facilitates:

  • Rapid iteration of glycoprotein designs

  • Incorporation of multiple antigens

  • Creation of optimized vaccine platforms

Structure-guided engineering:

  • Application of cryo-EM and X-ray crystallography to inform rational design

  • Computational modeling to predict glycoprotein stability and immunogenicity

  • Structure-based design of chimeric glycoproteins with enhanced properties

Novel delivery systems:

  • Nanoparticle formulations to enhance stability and immunogenicity

  • Controlled-release systems for prolonged antigen presentation

  • Mucosal delivery systems for enhanced protection at viral entry sites

Integration with gene editing technologies:

  • CRISPR-Cas9 systems for precise genome modification

  • Creation of cellular models with defined receptor expression

  • Engineering of recombinant VSV with inducible glycoprotein expression

As noted in research on VSV-based therapeutics: "Exploitation of reverse genetic tools may assist the creation of recombinant viral variants that have improved onco-selectivity and more efficient vaccine vector activity. This will add to the preferential features of VSV as an excellent advanced therapy medicinal product (ATMP) platform" .

What are the unresolved questions regarding VSV glycoprotein G structure-function relationships that warrant further investigation?

Despite significant progress in understanding VSV glycoprotein G, several critical structure-function questions remain unresolved and warrant further investigation:

Structural determinants of pathogenicity:
The observation that G glycoprotein is "a determinant of VSV virulence in a natural host" raises questions about:

  • Which specific domains or residues confer increased pathogenicity in natural hosts

  • Why GNJ causes more severe disease in swine while being attenuated in mice

  • The molecular basis for tissue tropism differences between serotypes

Receptor interaction dynamics:

  • Detailed mapping of the LDLR binding interface and additional potential receptors

  • Conformational changes during receptor binding and membrane fusion

  • Influence of glycosylation patterns on receptor recognition

Immune evasion and recognition:

  • Antigenic determinants that drive serotype-specific neutralizing antibody responses

  • Structural basis for the "dominance of the Indiana serotype in the serological response" observed in bivalent constructs

  • Mechanisms of immune recognition that differ between laboratory models and natural hosts

Glycoprotein incorporation mechanisms:
Research has shown that "many different membrane proteins may be co-incorporated quite efficiently with VSV G protein into budding VSV virus particles and that specific signals are not required for this co-incorporation process" . This observation raises questions about:

  • The mechanism facilitating efficient incorporation of diverse glycoproteins

  • Structural constraints that might limit incorporation of certain proteins

  • Potential for engineering optimal incorporation signals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.