Recombinant Vi polysaccharide export inner-membrane protein vexB (vexB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant VexB

Recombinant VexB is produced in Escherichia coli with an N-terminal histidine (His) tag for purification. Key properties include:

PropertyDetails
Source OrganismSalmonella typhi
Expression HostEscherichia coli
Protein LengthFull-length (1–264 amino acids)
Amino Acid SequenceMNILKNNSYYFMKLITVCELIILLMSRDIKTRYNGNLLNYMMVLAVPLVWISITVISFQYLNRSVPISTDDISFVIAGILPYLLFRYTITATMRTHSFSTSLAVVSQVKKRHVIFSLAAIEFVNAVIIYIIISLINFLIFSRWEAQKPFLIFEGMVIAWLLGLSFGYFCDALSERFPLVYKAVPVMLRPMFLISAVFYTANELPYSLLSIFSWNPLLHANEIVREGMFEGYHSLYLEPFYPLAFSATLFLAGLIFHLICDTENH
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C

Functional Role in Vi Polysaccharide Transport

VexB operates within the viaB locus, a pathogenicity island (SPI-7) encoding Vi polysaccharide synthesis and export genes . The ABC transporter complex comprises:

ComponentFunction
VexAInner-membrane subunit
VexBInner-membrane subunit (anchors the transporter)
VexCATPase subunit (hydrolyzes ATP to energize transport)
VexDPermease subunit

This system translocates Vi polysaccharide from the cytoplasm to the outer membrane, where it forms a protective capsule . Disruption of vexB abolishes surface Vi display, rendering S. typhi susceptible to serum killing .

4.1. Genetic Knockout Studies

  • Deletion of vexB in S. typhi eliminates Vi surface expression but retains intracellular polysaccharide accumulation, confirming its exclusive role in export .

  • Complementation with recombinant vexB restores serum resistance in vexB-deficient strains .

4.2. Regulatory Interactions

  • Vi expression is regulated by TviA, which interacts with RcsB and OmpR to activate vex operon transcription under low-osmolarity conditions .

  • Constitutive vexB expression via engineered promoters enhances Vi production in vaccine strains .

Applications in Research and Biotechnology

  • Vaccine Development: Vi polysaccharide is a licensed typhoid vaccine antigen . Recombinant VexB aids in studying transport mechanisms to optimize Vi yield in vaccine production.

  • Antibiotic Targeting: The VexABCDE transporter is a potential target for antivirulence therapies .

Comparative Analysis of Vi Export Systems

OrganismTransport SystemVirulence Role
S. typhiVexABCDE (ABC transporter)Essential for serum resistance and pathogenesis
E. coli (Group II capsules)KpsMTStructurally analogous but antigenically distinct

Challenges and Future Directions

  • Structural Resolution: Cryo-EM studies of the VexABCDE complex are needed to elucidate transport mechanics.

  • Regulatory Networks: Further analysis of TviA-RcsB interactions could enable controlled Vi expression in industrial settings .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specified tag type, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
vexB; STY4654; t4347; Vi polysaccharide export inner-membrane protein VexB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Salmonella typhi
Target Names
vexB
Target Protein Sequence
MNILKNNSYYFMKLITVCELIILLMSRDIKTRYNGNLLNYMMVLAVPLVWISITVISFQY LNRSVPISTDDISFVIAGILPYLLFRYTITATMRTHSFSTSLAVVSQVKKRHVIFSLAAI EFVNAVIIYIIISLINFLIFSRWEAQKPFLIFEGMVIAWLLGLSFGYFCDALSERFPLVY KAVPVMLRPMFLISAVFYTANELPYSLLSIFSWNPLLHANEIVREGMFEGYHSLYLEPFY PLAFSATLFLAGLIFHLICDTENH
Uniprot No.

Target Background

Function
May form an ATP-driven Vi polysaccharide export apparatus, in association with the VexA, VexC and VexD proteins.
Database Links

KEGG: stt:t4347

STRING: 220341.STY4654

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is vexB and what is its role in bacterial pathogenesis?

VexB is one of five genes (vexA, vexB, vexC, vexD, and vexE) involved in the translocation of Vi polysaccharide in Salmonella typhi. The Vi polysaccharide is a capsular antigen that forms a protective layer around the bacterium. VexB functions as a component of the ATP-binding cassette (ABC) transporter system responsible for exporting the Vi polysaccharide across the inner membrane to the cell surface. The VexB protein shows moderate similarity to components of group II capsule transporters found in other bacterial species .

The Vi antigen is crucial for S. typhi pathogenesis, as it has been confirmed to be necessary for serum resistance of S. typhi, protecting the bacterium from complement-mediated killing and phagocytosis during infection. This was reconfirmed through studies with isogenic Vi+ and Vi- strains, demonstrating the essential role of the Vi transport system, including VexB, in bacterial virulence .

How does vexB interact with other genes in the Vi polysaccharide biosynthesis pathway?

VexB works in concert with multiple other genes within two major functional categories:

Transport System (Translocation):

  • VexA: Inner membrane component of ABC transporter

  • VexB: Inner membrane component of ABC transporter

  • VexC: Contains putative ATP-binding site, providing energy for transport

  • VexD: Additional component of the transport system

  • VexE: Additional component involved in translocation

Biosynthesis System:

  • VipA: NAD/NADP-dependent enzyme for nucleotide sugar synthesis

  • VipB: NAD/NADP-dependent enzyme for nucleotide sugar synthesis

  • VipC: Additional biosynthetic enzyme

These proteins function as an integrated system where the Vip proteins synthesize the Vi polysaccharide, while the Vex proteins collaborate to export it across the membrane. VexB specifically functions within the inner membrane portion of this machinery, forming part of the translocation channel .

What experimental methods are used to identify and characterize vexB in laboratory settings?

The characterization of vexB typically employs a multi-faceted approach:

Table 1: Experimental Methods for vexB Characterization

MethodApplicationAdvantagesLimitations
DNA SequencingDetermining complete nucleotide sequenceProvides definitive genetic informationDoesn't demonstrate function
MutagenesisCreating gene knockouts or point mutationsDemonstrates gene function through phenotypic changesMay have polar effects on downstream genes
SubcloningIsolating vexB and related genesAllows study of specific gene functionMay remove regulatory elements
Complementation AnalysisRestoring function in mutantsConfirms gene functionRequires viable mutant strains
Expression in Heterologous HostsTesting function in E. coliDemonstrates transferability of functionHost differences may affect results
Bioinformatic AnalysisComparing to known transportersPredicts function based on homologyRequires experimental validation

For vexB specifically, researchers successfully characterized its function by determining the complete nucleotide sequence of the plasmid pGBM124 containing a 14-kb S. typhi chromosomal DNA fragment, then performing mutagenesis, subcloning, and complementation analysis to confirm its role in Vi polysaccharide transport .

What experimental design approaches are most effective for studying vexB functionality?

When investigating vexB functionality, true experimental research designs yield the most reliable results. The most effective experimental approach follows these methodological principles:

Variables Definition and Control:

  • Independent Variable: The specific aspect of vexB being manipulated (e.g., presence/absence through knockout, specific mutations, expression levels)

  • Dependent Variable: Measurable outcomes (e.g., Vi polysaccharide production, bacterial serum resistance, membrane localization)

  • Control Variables: Genetic background, growth conditions, and other environmental factors

Randomization and Replication:
Proper experimental design requires randomization to minimize systematic bias and adequate replication to ensure statistical validity. For vexB studies, this means:

  • Multiple independent bacterial cultures

  • Random assignment of treatments

  • Blinded assessment of phenotypes

  • Statistical analysis accounting for experimental variability

Control Groups:
Each experiment should include appropriate controls:

  • Wild-type strain (positive control)

  • Complete vexB deletion (negative control)

  • Complemented mutant (restoration of function)

  • Empty vector controls for expression studies

This structured approach allows researchers to establish causality between vexB modifications and observed phenotypes while controlling for extraneous variables that might confound results.

How can researchers address contradictions in experimental results when studying vexB?

When researchers encounter contradictory results in vexB studies, a systematic approach to addressing these contradictions is essential:

  • Identify the Specific Contradiction:
    First, precisely define where results diverge. Is it in protein localization, functional activity, or interaction with other components?

  • Apply Utterance-Based Contradiction Detection:
    This approach involves examining specific claims or "utterances" in published literature to pinpoint exactly where contradictions occur. For each contradiction, researchers should:

    • Isolate the specific contradictory statements

    • Identify supporting evidence for each statement

    • Determine if the contradiction stems from methodological differences

  • Thresholding Analysis:
    Establish a threshold (τ) for determining when differences in results constitute actual contradictions versus experimental variation. This involves:

    • Comparing reported effects using statistical methods

    • Determining if differences exceed expected variation (τ = 0.5 is often used as default)

  • Resolution Strategies:

    • Repeat experiments using standardized methods across conditions

    • Explore whether different bacterial strains or growth conditions explain divergent results

    • Consider whether contradictions reflect genuine biological variability in vexB function

    • Implement structured analysis approaches (e.g., RoBERTa models trained on contradictory datasets have shown 97.46% accuracy in contradiction detection)

By systematically analyzing contradictions, researchers can turn apparent inconsistencies into opportunities for deeper understanding of vexB functionality.

What are the optimal methods for producing recombinant VexB protein for structural and functional studies?

Producing functional recombinant VexB presents significant challenges due to its nature as an inner membrane protein. The following methodological approach optimizes expression and purification:

Expression System Selection:

  • E. coli-based systems: BL21(DE3) strains are typically preferred due to their reduced protease activity. C41(DE3) and C43(DE3) strains are specifically engineered for membrane protein expression.

  • Expression vectors: pET series vectors with T7 promoters allow controlled induction with IPTG. Include a fusion tag (His6, MBP, or SUMO) to facilitate purification and potentially enhance solubility.

Optimization Parameters:

  • Induction at lower temperatures (16-25°C) to slow protein production and facilitate proper folding

  • Reduced inducer concentration (0.1-0.5 mM IPTG rather than standard 1 mM)

  • Extended expression time (overnight rather than 3-4 hours)

  • Addition of membrane-stabilizing compounds to growth media

Membrane Protein Extraction:

  • Cell disruption via sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation via ultracentrifugation

  • Detergent screening to identify optimal solubilization conditions (typically DDM, LDAO, or C12E8)

  • Affinity purification under conditions that maintain native protein conformation

Functional Verification:
Following purification, verify functionality through:

  • Reconstitution into liposomes

  • ATP binding/hydrolysis assays

  • Interaction studies with other Vex components

  • Limited proteolysis to assess proper folding

This approach maximizes the likelihood of obtaining functionally active VexB protein suitable for biochemical and structural characterization.

How does the ATP-binding cassette (ABC) transporter system containing VexB compare to other bacterial polysaccharide transport systems?

VexB functions as part of an ATP-binding cassette (ABC) transporter that exhibits both similarities and differences compared to other bacterial polysaccharide transport systems:

Table 2: Comparison of VexB-Containing Transport System with Other Bacterial Polysaccharide Transporters

CharacteristicVi Polysaccharide Transport System (VexABCDE)Group II Capsule TransportersGroup I Capsule Transporters
Energy SourceATP hydrolysis via VexCATP hydrolysisProton motive force
Membrane ComponentsMultiple (VexA, VexB, VexD, VexE)Two inner membrane proteinsSingle inner membrane protein
ATP-Binding DomainPresent in VexCPresentAbsent
Transport MechanismABC transporterABC transporterWzx/Wzy-dependent pathway
Associated BiosynthesisNAD/NADP-dependent (VipA, VipB)Variable depending on organismTypically uses undecaprenyl phosphate carrier
Physiological RoleSerum resistanceHost immune evasionHost immune evasion

The VexB-containing system shows particular similarity to group II capsule transporters, with VexA, VexB, VexC, and VexD showing moderate sequence similarities to components of these systems. This suggests evolutionary relationships between these transport mechanisms while maintaining specific adaptations for the Vi polysaccharide .

The ATP-binding site in VexC provides the energy required for active transport across the inner membrane, with VexB serving as one of the channel-forming components that facilitates the actual movement of the polysaccharide through the membrane.

What bioinformatic approaches can be used to identify potential vexB homologs in other bacterial species?

Identifying vexB homologs across bacterial species requires a multi-faceted bioinformatic approach:

  • Sequence-Based Methods:

    • BLAST (Basic Local Alignment Search Tool) searches using S. typhi VexB as the query sequence

    • Position-Specific Iterated BLAST (PSI-BLAST) for detecting distant homologs

    • Multiple Sequence Alignment (MSA) using MUSCLE or Clustal Omega to identify conserved domains

    • Hidden Markov Models (HMMs) to create profiles of VexB-like proteins

  • Structural Prediction Approaches:

    • Secondary structure prediction using PSIPRED

    • Transmembrane domain prediction using TMHMM or Phobius

    • Tertiary structure modeling using AlphaFold2 or RoseTTAFold

    • Structural similarity searches using DALI or TM-align

  • Genomic Context Analysis:

    • Examination of gene neighborhoods to identify conserved operons

    • Identification of co-occurring genes (vexA, vexC, vexD, vexE)

    • Synteny analysis to identify reorganized but functionally related gene clusters

  • Functional Prediction:

    • Gene Ontology (GO) term association

    • KEGG pathway mapping

    • Protein domain identification using Pfam and InterPro

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees to visualize evolutionary relationships

    • Identification of orthologous and paralogous relationships

    • Detection of horizontal gene transfer events

By combining these approaches, researchers can identify potential VexB homologs even in distantly related bacterial species, providing insights into the evolution and distribution of Vi-like polysaccharide transport systems.

What are the key considerations for designing experiments to study the effect of vexB mutations on bacterial virulence?

Designing robust experiments to assess how vexB mutations affect virulence requires careful consideration of multiple experimental variables:

Experimental Design Framework:

  • Hypothesis Formulation:

    • Clearly state the expected relationship between specific vexB mutations and virulence phenotypes

    • Develop null and alternative hypotheses that are testable and falsifiable

  • Mutation Strategy:

    • Site-directed mutagenesis for targeted amino acid changes

    • Deletion mutagenesis to remove functional domains

    • Random mutagenesis for unbiased functional screening

    • Silent mutations as controls to verify phenotypes are not due to unintended effects

  • Control Selection:

    • Wild-type strain (positive control)

    • Complete vexB deletion (negative control)

    • Complemented mutant strains to confirm phenotype restoration

    • Strains with mutations in related vex genes to assess system-wide effects

  • Virulence Assessment Methods:

    • In vitro assays: serum resistance, adherence, invasion

    • Cell culture models: macrophage survival, epithelial cell interaction

    • Animal infection models: colonization, persistence, pathology

    • Competitive index experiments comparing mutant vs. wild-type directly

  • Confounding Variable Control:

    • Growth rate normalization

    • Equal inoculum preparation

    • Blinded assessment of phenotypes

    • Randomized experimental groups

  • Statistical Analysis Planning:

    • Power analysis to determine sample size

    • Appropriate statistical tests based on data distribution

    • Multiple testing correction for large-scale studies

    • Effect size calculation to assess biological significance

This comprehensive experimental design approach enables researchers to establish clear cause-effect relationships between vexB mutations and virulence phenotypes while minimizing confounding variables and experimental bias.

How can researchers effectively combine structural biology and functional analysis to understand VexB mechanism of action?

An integrated approach combining structural biology with functional analysis provides the most comprehensive understanding of VexB:

Structural Characterization:

  • Membrane Protein Crystallography:

    • Lipidic cubic phase crystallization

    • X-ray diffraction analysis

    • Structure determination and refinement

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single particle analysis

    • Tomography for in situ visualization

    • Sub-tomogram averaging

  • Nuclear Magnetic Resonance (NMR):

    • Solution NMR for flexible domains

    • Solid-state NMR for transmembrane regions

    • Chemical shift analysis for dynamics

  • Computational Modeling:

    • Molecular dynamics simulations

    • Docking studies with Vi polysaccharide

    • Protein-protein interaction prediction with other Vex components

Functional Analysis:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified from structural studies

    • Create alanine scanning libraries across transmembrane domains

    • Generate chimeric proteins with related transporters

  • Transport Assays:

    • Reconstitution into proteoliposomes

    • Fluorescent labeling of Vi polysaccharide

    • Real-time transport kinetics measurement

  • Interaction Studies:

    • Co-immunoprecipitation with other Vex proteins

    • Fluorescence resonance energy transfer (FRET)

    • Cross-linking coupled with mass spectrometry

  • In Vivo Assessment:

    • Complementation of vexB mutants with modified genes

    • Fluorescent protein tagging for localization studies

    • Bacterial two-hybrid analysis

By iteratively applying structural insights to guide functional studies and using functional data to refine structural models, researchers can develop a comprehensive understanding of how VexB contributes to Vi polysaccharide transport at the molecular level.

What are the current knowledge gaps and future research directions for vexB studies?

Despite significant progress in understanding vexB and its role in Vi polysaccharide transport, several important knowledge gaps remain:

  • Structural Characterization:
    The high-resolution structure of VexB remains undetermined, limiting our understanding of its precise mechanism of action. Future research should prioritize structural studies using advanced techniques like cryo-EM or X-ray crystallography.

  • Transport Mechanism:
    The exact steps by which Vi polysaccharide moves through the VexB-containing transporter complex are not fully elucidated. Real-time transport assays and single-molecule studies could provide crucial insights.

  • Regulatory Networks:
    How expression of vexB and other vex genes is regulated in response to environmental conditions remains poorly understood. Transcriptomic and promoter analysis studies are needed.

  • Host-Pathogen Interactions:
    While Vi antigen is known to contribute to serum resistance, the specific interactions between host immune components and bacteria expressing different levels of VexB require further investigation .

  • Evolutionary Aspects:
    Comparative genomics studies across bacterial species could reveal how VexB-like transporters have evolved and diversified for different polysaccharides.

  • Therapeutic Targeting:
    Given the importance of Vi polysaccharide for virulence, research into small molecule inhibitors of VexB could lead to novel therapeutic approaches for typhoidal Salmonella infections.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, molecular genetics, biochemistry, and infectious disease research. The continued study of vexB not only enhances our understanding of bacterial polysaccharide transport but also provides potential avenues for intervention against important human pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.