Recombinant Vi polysaccharide export inner-membrane protein vexD (vexD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vexD; STY4652; t4345; Vi polysaccharide export inner-membrane protein VexD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Salmonella typhi
Target Names
vexD
Target Protein Sequence
MENSERIKKWKEERAKVAQESRASRLQQKEDERALRQTEKSADAKSHHNPDAGWSATDAD SVRRASLVIKERRVQQAKQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDAS QDNFSGTSFFGAGNKMSEGFQVREFILSKEMMDRMEKELGFLSYFAQDDIALFSRFHAPL GINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQHVNTVSARMQ KERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKA EYAQLMVNGLDQNPLIPRLSAKIKVLEKQIGEQRNRLSNKLGSQGSSESLSLFEDLRLQS EIAKARWESALQTLQQGKLQALRERQYLLIISQPMAESDTTRYADGTKWLLFFVLLGITY LVTSLLITIRRMRE
Uniprot No.

Target Background

Function
This protein is involved in the ATP-driven export of capsule polysaccharides, likely in conjunction with VexA, VexB, and VexC proteins.
Database Links

KEGG: stt:t4345

STRING: 220341.STY4652

Protein Families
BexC/CtrB/KpsE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of VexD in Vi antigen biosynthesis?

VexD functions as part of the Vi antigen export system, likely working in conjunction with other Vex proteins to facilitate the translocation of Vi polysaccharide to the bacterial cell surface. While specific information on VexD is limited in current literature, we can infer its function based on related proteins in the same pathway. For instance, VexE is a dedicated acyltransferase associated with proper acylation of Vi antigen and is essential for efficient export and retention of the capsular polysaccharide (CPS) glycan at the cell surface . VexD likely plays a complementary role in this export machinery, potentially as part of a larger complex that recognizes the terminal glycolipid signal to facilitate translocation of the completed product to the cell surface.

How does VexD interact with other proteins in the Vi export pathway?

Based on current understanding of capsular polysaccharide export systems, VexD likely functions as part of a multi-protein complex that includes other Vex proteins and potentially additional membrane-associated factors. This complex would work together to recognize the fully synthesized Vi antigen and facilitate its movement across the inner membrane. The terminal glycolipid is thought to provide a signal recognized by the export machinery, which would include VexD, to facilitate translocation of the completed product to the cell surface . Research approaches to study these interactions would include protein-protein interaction studies such as co-immunoprecipitation, bacterial two-hybrid systems, or crosslinking experiments to capture transient interactions.

What expression systems are optimal for recombinant VexD production?

  • Use of specialized E. coli strains designed for membrane protein expression

  • Regulated expression at lower temperatures (16-25°C) to slow folding

  • Addition of fusion tags that enhance solubility

  • For functional studies, consider homologous expression systems that naturally produce Vi antigen

When assessing expression, Western blot analysis should be performed on membrane fractions rather than whole cell lysates to verify proper membrane localization of the recombinant protein.

How can structural studies of VexD inform mechanism of Vi antigen export?

Determining the structure of VexD would provide critical insights into the mechanism of Vi antigen export. As a membrane protein, structural determination presents significant challenges that can be addressed through multiple complementary approaches:

  • X-ray crystallography after detergent solubilization and purification

  • Cryo-electron microscopy for visualization of the protein in near-native states

  • NMR studies of specific domains or peptides derived from VexD

Structural information would reveal potential binding sites for the Vi antigen or other components of the export machinery. This could elucidate how the terminal glycolipid acts as a signal for export . Additionally, structural characterization would identify conserved domains that might function similarly across different bacterial species, providing broader insights into capsular polysaccharide export systems.

What are the differences in function between VexD and VexE in the Vi export system?

Based on the available information, VexE is a dedicated acyltransferase essential for proper acylation, efficient export, and retention of the CPS glycan at the cell surface . VexD likely performs a distinct but complementary function in the export process. To characterize the functional differences, researchers should consider:

  • Generating knockout mutants for each gene separately and analyzing phenotypic differences

  • Performing complementation studies to determine if one protein can rescue defects caused by loss of the other

  • Conducting biochemical assays to identify the specific substrates and products of each protein

  • Using fluorescently tagged variants to visualize localization patterns during Vi biosynthesis

A comprehensive analysis would involve examining differences in Vi antigen structure, localization, and abundance when either VexD or VexE is altered or absent, providing insights into their specific roles in the export pathway.

How do environmental factors influence VexD expression and function?

Environmental conditions likely modulate VexD expression and function, affecting Vi antigen production and export. To investigate this relationship, researchers should design experiments that systematically vary conditions while monitoring VexD levels and Vi export efficiency:

Environmental FactorMeasurement TechniquesExpected Impact
TemperatureqRT-PCR, Western blot, Vi quantificationHigher temperatures may increase expression but impact protein folding
pHReporter gene assays, Vi ELISAAcidic conditions might stimulate expression as part of stress response
OsmolarityMembrane fractionation, Activity assaysHigh osmolarity may alter membrane properties affecting function
Nutrient availabilityTranscriptome analysis, Metabolic labelingNutrient limitation may trigger regulatory pathways affecting expression

Data from these experiments should be analyzed using statistical methods that account for the complex interactions between variables. Experimental design should include appropriate controls and multiple biological replicates to ensure reliability .

What are the optimal methods for purifying functional VexD protein?

Purifying functional membrane proteins like VexD requires specialized approaches to maintain native structure and function. A methodological workflow would include:

  • Membrane isolation: Begin with gentle cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent selection: Screen multiple detergents (e.g., DDM, LMNG, CHAPS) at various concentrations to identify optimal solubilization conditions that maintain protein stability.

  • Affinity purification: Utilize engineered affinity tags (His, Strep, FLAG) positioned at termini least likely to interfere with function.

  • Size exclusion chromatography: Remove aggregates and separate monomeric from oligomeric forms.

  • Functional verification: Develop in vitro assays to confirm that purified VexD retains its native activity.

Throughout the purification process, researchers should monitor protein stability using techniques such as thermal shift assays and limited proteolysis. Additionally, incorporation of the purified protein into liposomes or nanodiscs may provide a more native-like environment for functional studies.

How can genetic approaches be used to study VexD function in vivo?

Genetic manipulation provides powerful tools for investigating VexD function within its native context. Consider these methodological approaches:

  • Gene deletion and complementation: Generate clean deletions of vexD using allelic exchange, followed by complementation with wild-type or mutated versions to confirm phenotypes and identify critical residues.

  • Conditional expression systems: For essential genes, employ inducible promoters or degradation tags to create conditional knockdowns.

  • Fluorescent protein fusions: Create C- or N-terminal fusions to visualize localization patterns, ensuring the fusion doesn't disrupt function.

  • Site-directed mutagenesis: Target conserved residues to identify functionally important amino acids.

  • Suppressor screens: Isolate suppressors of vexD mutations to identify genetic interactions and pathway components.

When interpreting results, researchers must consider the potential for polar effects on downstream genes and the possibility that artificial expression levels may not reflect native conditions. Controls should include complementation with the wild-type gene to verify that phenotypes are specific to vexD .

What bioinformatic approaches are useful for studying VexD homologs across bacterial species?

Comparative bioinformatics can reveal evolutionary relationships and functional conservation of VexD among different bacterial species:

  • Sequence alignment and phylogenetic analysis: Identify conserved domains and evolutionary relationships using tools like MUSCLE, CLUSTAL, and RAxML.

  • Structural prediction: Generate structural models using homology modeling (SWISS-MODEL) or AI-based approaches (AlphaFold) when experimental structures are unavailable.

  • Genomic context analysis: Examine gene neighborhoods across species to identify conserved operonic structures and potential functional partners.

  • Domain architecture analysis: Identify protein domains using databases like Pfam and SMART to predict functional capabilities.

  • Coevolution analysis: Detect co-evolving residues that might indicate interaction surfaces or functional constraints.

Researchers should validate bioinformatic predictions experimentally, as sequence similarity doesn't always translate to functional equivalence. Combining multiple approaches and integrating experimental data will provide the most robust insights into VexD function across species.

How can optimal experimental design principles be applied to VexD functional studies?

When designing experiments to investigate VexD function, researchers should apply principled design approaches to maximize information yield while minimizing resources:

  • Identify clear research questions and appropriate outcome measures before beginning experiments.

  • Use factorial designs to efficiently explore multiple variables and their interactions simultaneously.

  • Consider using optimal design algorithms to select the most informative experimental conditions. For complex models with multiple parameters, optimal experimental design can significantly improve parameter estimation precision .

  • When working with large datasets, implement retrospective designed sampling approaches to extract the most informative subset of data for specific questions .

  • Include appropriate positive and negative controls for each experiment, including isogenic strains lacking vexD.

The utility of an experimental design can be quantified using information-theoretic measures such as the determinant of the observed information matrix, allowing researchers to compare different possible designs objectively . As shown in experimental design literature, a properly designed subset of data can often provide nearly the same statistical power as the full dataset, potentially doubling efficiency .

What approaches can resolve contradictory results in VexD research?

When faced with contradictory results about VexD function or interactions, researchers should:

  • Systematically analyze methodological differences between studies, including:

    • Expression systems and tags used

    • Buffer and detergent conditions

    • Assay conditions and readouts

    • Genetic backgrounds of bacterial strains

  • Develop trace-based explanation approaches that examine the specific methods and decision points in each study to identify where discrepancies originated .

  • Create a functional representation of VexD's proposed mechanisms to justify contradictory knowledge claims, linking observed behavior to deep models of membrane protein function .

  • Design critical experiments specifically targeted to discriminate between competing hypotheses, rather than simply repeating previous work.

  • Consider whether contradictory results might reflect actual biological variability under different conditions rather than experimental artifacts.

In cases where results cannot be reconciled through methodological analysis, computational modeling can sometimes provide insights by simulating how different experimental conditions might lead to apparently contradictory outcomes.

How can researchers overcome challenges in studying VexD interactions with other components of the Vi export machinery?

Investigating protein interactions in membrane-associated complexes presents unique challenges that require specialized approaches:

  • In vivo crosslinking: Use membrane-permeable crosslinkers with various spacer arms to capture transient interactions, followed by pull-down assays and mass spectrometry.

  • Split reporter systems: Employ bacterial two-hybrid or split-GFP systems optimized for membrane proteins to detect interactions without disrupting the membrane environment.

  • Co-purification strategies: Develop mild solubilization conditions that preserve protein complexes, potentially using specialized detergents or native nanodiscs.

  • Förster resonance energy transfer (FRET): Tag potential interaction partners with appropriate fluorophore pairs to detect proximity in native membranes.

  • Genetic interaction mapping: Create comprehensive genetic interaction networks through systematic double-mutant analysis.

Researchers should triangulate findings using multiple complementary techniques, as each method has inherent limitations and biases. When analyzing interaction data, consider both direct and indirect interactions, as membrane proteins often function in larger complexes where not all components interact directly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.