Recombinant Vibrio anguillarum Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrC; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Vibrio anguillarum (Listonella anguillarum)
Target Names
nqrC
Target Protein Sequence
MASNNDSIKKTLFVVIALSLVCSIIVSTAAVGLRDKQKVNAVLDKQSKIVEVAGINESGS VPELFAKYIEPRLIDFKTGNFVDGDATAYDQRKASKDPAQSIKLTAEQDKAKIIRRANTG VVYLVKSGDEISKVIVPVHGNGLWSMMYAFVAVETDGNTVSGITYYEQGETPGLGGEVEN PSWRAQFVGKKLFDDNHQPAIKVVKGGAPAGSEHGVDGLSGATLTSNGVQHTFDFWLGDM GFGPFLAKVRDGGLN
Uniprot No.

Target Background

Function
The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE likely participate in the second step, converting ubisemiquinone to ubiquinol.
Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of nqrC in the Na+-NQR complex of Vibrio anguillarum?

NqrC functions as a critical subunit of the Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) complex in Vibrio anguillarum. It serves as one of the primary components in the electron transport chain responsible for energy metabolism. Specifically, nqrC contains a covalently bound flavin mononucleotide (FMN) cofactor that participates in electron transfer within the complex. The subunit undergoes significant conformational changes during the catalytic cycle, which is essential for coupling electron transfer to sodium ion translocation across the bacterial membrane . This ion translocation generates an electrochemical gradient that drives various cellular processes, including ATP synthesis, making nqrC vital for bacterial energy conservation.

How does the Na+-NQR complex differ between Vibrio species?

The Na+-NQR complex exhibits similar core functions across Vibrio species but with notable structural and functional variations. In Vibrio cholerae, the complex has been shown to generate a sodium gradient through large conformational changes that couple electron transfer to ion translocation . These conformational changes have been confirmed through both cryo-EM and X-ray structures representing various stages of the catalytic cycle.

In Vibrio anguillarum, the complex similarly functions in sodium translocation but may have distinct regulatory mechanisms. Unlike other NADH:quinone oxidoreductases, the Na+-NQR complex contains unique cofactor arrangements, including multiple flavins. Research indicates that the neutral flavosemiquinone radical in the complex arises from the riboflavin cofactor rather than from the FMN molecules as previously suggested . These species-specific differences must be considered when designing experiments or interpreting results across different Vibrio species.

What are the key cofactors in the nqrC subunit, and how do they contribute to function?

The nqrC subunit contains a covalently bound FMN cofactor attached to a threonine residue (Thr225), which is critical for electron transfer within the Na+-NQR complex. The covalent attachment occurs through a phosphoester bond between the phosphate group of FMN and the hydroxyl group of Thr225 . This arrangement stabilizes the cofactor and facilitates precise positioning for electron transfer.

When mutated (NqrC-T225Y), the covalent binding site for FMN is eliminated, leading to altered complex activity . The entire Na+-NQR complex contains four flavin cofactors in total: two covalently bound FMNs (one in nqrB and one in nqrC), one non-covalently bound FAD in nqrF, and one riboflavin. The coordinated action of these cofactors creates a pathway for electron transfer from NADH to quinone, coupled with sodium ion translocation across the membrane.

What expression systems are optimal for producing recombinant nqrC protein?

For effective expression of recombinant nqrC, several systems have been employed with varying degrees of success. In experimental studies, attenuated strains of Vibrio anguillarum have proven particularly effective as they provide a native-like environment for proper protein folding and cofactor incorporation. The plasmid-free derivative MVAV6201, which is an effective live vaccine candidate, has been successfully used as a carrier strain for the secretory delivery of recombinant proteins .

For heterologous expression, the Escherichia coli alpha-haemolysin (HlyA) transport system has demonstrated high efficiency. This approach involves fusing recombinant proteins with the alpha-haemolysin secretion signal (HlyAs) and expressing them from the HlyA secretion vector pMOhly1 . This system has achieved secretion efficiencies of approximately 70% for some fusion proteins, with yields reaching around 300 μg/L as determined by Western blotting .

When expressing the entire Na+-NQR complex or multiple subunits, careful consideration must be given to the co-expression of all necessary components for proper assembly, including accessory proteins that may facilitate cofactor incorporation.

How can researchers confirm the proper incorporation of the FMN cofactor into recombinant nqrC?

Confirming proper FMN incorporation into recombinant nqrC requires multiple analytical approaches. Fluorescence spectroscopy of denatured protein preparations is an effective method to detect and quantify flavin cofactors. When analyzing the flavin content of mutants that lack covalently bound flavins (such as the NqrB-T236Y/NqrC-T225Y double mutant), distinct fluorescence patterns can be observed for different flavin types, allowing discrimination between FMN, FAD, and riboflavin .

Absorption spectroscopy can also be employed to monitor the characteristic peaks of oxidized and reduced flavins. For definitive identification, high-performance liquid chromatography (HPLC) coupled with high-resolution tandem mass spectrometry provides unequivocal confirmation of cofactor identity and modifications .

To verify covalent attachment, researchers can perform SDS-PAGE followed by fluorescence visualization before staining. Covalently bound flavins will fluoresce under UV light in association with the protein band. Additionally, site-directed mutagenesis of the threonine residue (Thr225) to tyrosine eliminates covalent FMN binding and can serve as a negative control in these assays .

What purification strategies maximize yield and activity of recombinant nqrC?

Purifying active recombinant nqrC requires strategies that preserve the native structure and cofactor integrity. A multi-step approach typically yields the best results:

  • Initial Capture: For secreted nqrC fusion proteins, concentration from culture supernatant using ammonium sulfate precipitation followed by dialysis against an appropriate buffer.

  • Affinity Chromatography: Incorporation of affinity tags (His-tag or GST) facilitates selective purification through immobilized metal affinity chromatography (IMAC) or glutathione sepharose columns.

  • Ion Exchange Chromatography: This step separates proteins based on charge differences and is particularly useful for removing contaminants with similar molecular weights.

  • Size Exclusion Chromatography: As a final polishing step, this technique separates proteins based on size and shape, yielding highly pure nqrC preparations.

Throughout purification, it's essential to maintain conditions that preserve cofactor association. Including small amounts of detergent (0.05-0.1% non-ionic) can help maintain protein solubility while preserving native structure. For the complete Na+-NQR complex containing nqrC, mild extraction from membranes using appropriate detergents followed by sucrose gradient centrifugation has proven effective before proceeding with chromatographic purification .

What structural changes does nqrC undergo during the Na+ translocation cycle?

The nqrC subunit undergoes significant conformational changes during the Na+ translocation cycle, which are essential for coupling electron transfer to ion movement. Cryo-EM and X-ray structures of the Na+-NQR complex have captured snapshots throughout the catalytic cycle, confirming large conformational shifts in nqrC . These structural rearrangements create the necessary environment for sodium ion binding and subsequent translocation across the membrane.

The conformational changes involve movements of key domains that alter the relative positions of the cofactors, particularly the covalently bound FMN. This facilitates electron transfer between the flavin centers while simultaneously creating and dissolving Na+ binding sites. The precise timing and coordination of these structural changes are critical for efficient energy coupling.

Mutations that restrict conformational flexibility, particularly in regions connecting different domains, can significantly impair Na+ translocation without necessarily affecting electron transfer, highlighting the importance of these structural dynamics for ion pumping activity .

How do mutations in the FMN binding site of nqrC affect complex assembly and function?

Mutations in the FMN binding site of nqrC have profound effects on both assembly and function of the Na+-NQR complex. The mutation of threonine 225 to tyrosine (T225Y) eliminates the covalent attachment site for FMN, significantly altering the electron transfer capabilities of the complex . While this mutation does not completely prevent complex assembly, it results in substantially reduced enzyme yields (approximately 10-20% compared to wild type) and compromised function .

The double mutant (NqrB-T236Y/NqrC-T225Y), lacking both covalently bound FMN cofactors, can still be expressed and assembled, though at much lower levels. This suggests that while the covalent FMN cofactors are not absolutely essential for initial complex assembly, they are critical for stability and function .

Attempts to create a triple mutant lacking three of the four flavins (NqrB-T236Y/NqrC-T225Y/NqrF-S246A) have been unsuccessful, with extremely poor growth and very low enzyme production, indicating that a minimal flavin complement is essential for viable complex formation .

What methodologies are most effective for studying the electron transfer pathway through nqrC?

Investigating the electron transfer pathway through nqrC requires a multi-faceted approach combining spectroscopic, biochemical, and computational methods:

  • Transient Absorption Spectroscopy: This technique can capture the rapid electron transfer events between cofactors with microsecond to picosecond resolution, allowing visualization of the sequential reduction and oxidation of flavin centers during catalysis.

  • Electron Paramagnetic Resonance (EPR): Particularly useful for identifying and characterizing the neutral flavosemiquinone radical states, EPR can provide insights into the redox states of flavin cofactors during the catalytic cycle .

  • Site-Directed Mutagenesis: Systematic mutation of residues potentially involved in electron transfer allows mapping of the pathway. The effects can be assessed through activity assays and spectroscopic techniques .

  • Computational Simulation: Molecular dynamics simulations and quantum mechanical calculations can predict electron transfer routes and energetics, complementing experimental data. These methods have been successfully applied to define potential quinone-binding sites and propose catalytic mechanisms in related oxidoreductases .

  • Stopped-Flow Kinetics: By rapidly mixing enzyme with substrates and monitoring spectral changes, researchers can determine rate constants for individual steps in the electron transfer process.

Integration of these methodologies provides a comprehensive understanding of the electron transfer pathway through nqrC and its role in Na+ translocation.

How should researchers design experiments to distinguish the functions of individual Na+-NQR subunits?

  • Subunit-Specific Mutagenesis: Create targeted mutations in conserved residues of each subunit, particularly those involved in cofactor binding or catalysis. For instance, the mutation NqrC-T225Y eliminates covalent FMN binding, allowing assessment of this specific function .

  • Chimeric Subunit Construction: Replace specific domains or regions of nqrC with corresponding segments from related species to identify species-specific functional elements.

  • Stepwise Reconstitution: Develop in vitro reconstitution systems where purified subunits are systematically added to monitor the emergence of specific functions. This approach can reveal which subunits are necessary and sufficient for particular activities.

  • Differential Inhibition: Utilize inhibitors with known binding sites on specific subunits to selectively impair functions associated with individual components.

  • Cross-linking Studies: Employ chemical cross-linking combined with mass spectrometry to identify interacting regions between subunits, providing insights into functional coupling.

When analyzing experimental results, it's crucial to consider the interdependent nature of the subunits. Disruption of one subunit may have cascading effects on others, complicating interpretation. Control experiments should include assessment of complex assembly and stability to distinguish direct functional effects from indirect consequences of structural perturbation .

What controls are essential when investigating Na+ transport by recombinant nqrC?

When investigating Na+ transport mediated by recombinant nqrC as part of the Na+-NQR complex, several critical controls must be incorporated:

  • K+ Selectivity Controls: Compare transport activity with K+ versus Na+ to confirm specificity. Na+-NQR should show significantly higher activity with Na+ than with K+.

  • Ionophore Controls: Include experiments with ionophores (such as monensin for Na+) that collapse the ion gradient to confirm that measured effects are due to vectorial ion transport rather than scalar reactions.

  • Proton Gradient Uncoupling: Use protonophores (like CCCP) to distinguish Na+ transport from proton transport, as some systems can utilize both ions.

  • Enzyme Activity Controls: Separate measurement of NADH oxidation and quinone reduction allows differentiation between electron transfer defects and ion transport impairments.

  • Mutant Controls: Include the NqrC-T225Y mutant lacking the covalent FMN as a comparison to assess the role of this cofactor in coupling electron transfer to ion transport .

  • Membrane Integrity Controls: For vesicle-based assays, verify membrane integrity using impermeant markers to ensure that ion movements are through the Na+-NQR complex rather than membrane leaks.

Interpretation of results should consider the cooperativity between subunits, as Na+ transport requires coordinated action of multiple components of the Na+-NQR complex, not just nqrC in isolation .

How can researchers effectively measure and interpret conformational changes in nqrC during catalysis?

Measuring and interpreting conformational changes in nqrC during catalysis requires techniques that can capture dynamic structural alterations:

  • Time-Resolved FRET (Förster Resonance Energy Transfer): By introducing fluorescent donor-acceptor pairs at strategic positions in nqrC, researchers can monitor distance changes between domains during catalysis with high temporal resolution.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of the protein that undergo changes in solvent accessibility during different catalytic states, revealing conformational dynamics.

  • Single-Molecule FRET: Provides insights into the heterogeneity of conformational states and transient intermediates that might be missed in ensemble measurements.

  • Cryo-EM Analysis of Trapped Intermediates: Using inhibitors or substrate analogs to trap specific catalytic states, followed by cryo-EM analysis, can provide structural snapshots throughout the catalytic cycle .

  • Molecular Dynamics Simulations: Computational approaches can predict conformational trajectories and energy landscapes, complementing experimental data.

When interpreting the data, researchers should correlate observed conformational changes with specific catalytic events. For instance, changes observed upon NADH binding versus quinone binding can help differentiate substrate-specific conformational responses. Additionally, comparing wild-type nqrC with mutants having altered catalytic properties can establish causative relationships between structural changes and function .

How can nqrC be engineered for use as a research tool in bioenergetics studies?

The unique properties of nqrC make it a valuable platform for engineering specialized research tools in bioenergetics:

  • Biosensor Development: By fusing fluorescent proteins to specific domains of nqrC, researchers can create real-time sensors for monitoring ion gradients or redox states in bacterial systems. The proven success of fusing green fluorescent protein with secretion signals (GFP-HlyAs) demonstrates the feasibility of creating functional fusion proteins with nqrC .

  • Electron Transfer Probes: The FMN cofactor in nqrC can serve as a reporter group for electron transfer events. Modifications to the protein environment around this cofactor can create specialized probes for investigating electron tunneling mechanisms or redox potential modulation.

  • Minimal Model Systems: Engineered versions of nqrC incorporated into liposomes or nanodiscs can serve as simplified models for studying specific aspects of ion-coupled electron transfer without the complexity of the complete Na+-NQR system.

  • Redox Switch Development: The conformational changes that nqrC undergoes during catalysis could be harnessed to create molecular switches that respond to specific redox conditions, useful for synthetic biology applications.

  • Chimeric Energy-Converting Enzymes: By combining domains from nqrC with components from other ion-translocating enzymes, researchers can create hybrid systems to investigate fundamental principles of energy conversion.

Successful engineering requires detailed knowledge of structure-function relationships in nqrC. Particularly promising are approaches that leverage the conformational dynamics observed during the catalytic cycle to create responsive biomolecular tools .

What are the most promising approaches for resolving contradictory data on electron transfer through nqrC?

Resolving contradictory data on electron transfer through nqrC requires systematic approaches that address experimental inconsistencies:

  • Multiple Complementary Techniques: Employ various methods (spectroscopic, biochemical, computational) to examine the same phenomenon. For example, the source of the neutral flavosemiquinone radical was initially attributed to one of the FMN molecules, but later evidence indicated it arose from the riboflavin cofactor . Such contradictions can be resolved by combining EPR spectroscopy, site-directed mutagenesis, and fluorescence spectroscopy.

  • Standardized Preparation Methods: Develop consensus protocols for enzyme preparation to eliminate variation from different purification approaches. Document key parameters such as detergent concentration, buffer composition, and metal content.

  • Direct Comparison Studies: Design experiments that directly compare contradictory results under identical conditions. For instance, prepare single flavin deletion mutants alongside double mutants to systematically evaluate the effects of each modification .

  • Time-Resolved Measurements: Some contradictions arise from capturing different states of a dynamic process. Using techniques with appropriate time resolution can reveal the sequence of electron transfer events and reconcile apparently conflicting observations.

  • Environmental Sensitivity Analysis: Systematically vary experimental conditions (pH, ionic strength, temperature) to determine whether contradictory results stem from differential sensitivity to these parameters.

When addressing the specific contradiction regarding the source of the neutral flavosemiquinone radical, the construction of the double mutant (NqrB-T236Y/NqrC-T225Y) provided conclusive evidence by eliminating both FMN cofactors while retaining the riboflavin .

How might the nqrC subunit be utilized in comparative studies of Na+-translocating versus H+-translocating respiratory complexes?

Utilizing nqrC in comparative studies between Na+- and H+-translocating respiratory complexes can provide valuable insights into the fundamental mechanisms of ion specificity:

  • Chimeric Constructs: Create hybrid proteins containing domains from nqrC and corresponding subunits from H+-translocating complexes to identify regions responsible for ion specificity. These constructs can be assayed for their ability to translocate either Na+ or H+.

  • Conserved Motif Analysis: Compare the ion-binding sites and transport pathways between nqrC and H+-translocating counterparts to identify conserved structural elements with divergent functions.

  • Evolution-Guided Mutagenesis: Based on evolutionary analysis, introduce mutations that interconvert Na+ and H+ specificity to identify key determinants of ion selectivity.

  • Parallel Assay Systems: Develop standardized assay platforms that can measure Na+ and H+ translocation under identical conditions, allowing direct comparison of efficiency and regulation.

  • Bioinformatic Structural Mapping: Use computational approaches to map conserved and divergent features between Na+- and H+-translocating systems, guiding targeted experimental investigations.

These comparative approaches can address fundamental questions about the evolutionary relationship between these systems and the molecular basis for ion selectivity. Research has shown that conformational changes are crucial for ion translocation in Na+-NQR , and comparing these dynamics with those in H+-translocating complexes could reveal common principles of ion pumping mechanisms.

What are common pitfalls in the expression and purification of active recombinant nqrC, and how can they be overcome?

Several challenges commonly arise during expression and purification of active recombinant nqrC:

  • Insufficient Cofactor Incorporation:

    • Problem: Inadequate FMN incorporation leads to inactive protein.

    • Solution: Supplement growth media with riboflavin precursors and optimize induction conditions to allow sufficient time for cofactor incorporation before harvesting.

  • Proteolytic Degradation:

    • Problem: nqrC is susceptible to proteolysis during purification.

    • Solution: Include protease inhibitors throughout purification, minimize processing time, and maintain low temperatures. Consider using protease-deficient expression strains.

  • Loss of Activity During Purification:

    • Problem: The protein loses activity through multiple purification steps.

    • Solution: Minimize the number of purification steps and validate activity after each stage. Include stabilizing agents such as glycerol (10-15%) in all buffers.

  • Poor Yield:

    • Problem: Expression of complex proteins like nqrC often results in low yields, particularly when mutations affect assembly.

    • Solution: The NqrB-T236Y/NqrC-T225Y double mutant showed only 10-20% yield compared to wild type . Optimize expression by adjusting induction parameters, temperature, and duration. Consider using enriched media and specialized expression strains.

  • Aggregation:

    • Problem: Membrane-associated proteins tend to aggregate when expressed recombinantly.

    • Solution: Include appropriate detergents or amphipathic polymers during lysis and purification. Consider fusion tags that enhance solubility.

Successful expression has been achieved using secretory delivery systems based on the E. coli alpha-haemolysin transport system, with secretion efficiencies reaching approximately 70% for some fusion proteins .

How can researchers distinguish functional effects of mutations in nqrC from effects on complex assembly?

Distinguishing between direct functional effects and indirect assembly effects is crucial when interpreting mutation studies:

  • Quantitative Complex Assembly Analysis:

    • Use size exclusion chromatography to quantify intact complex formation

    • Employ blue native PAGE to assess complex integrity and stoichiometry

    • Compare cofactor content between wild-type and mutant preparations to identify specific deficiencies

  • Subunit Composition Verification:

    • Perform western blotting against all Na+-NQR subunits to ensure complete assembly

    • Use mass spectrometry to confirm the presence and stoichiometry of all components

  • Partial Reaction Analysis:

    • Measure individual electron transfer steps between defined redox centers

    • Assess NADH oxidation independent of quinone reduction to isolate specific functional defects

  • In vitro Reconstitution:

    • Attempt reconstitution of the complex from individually purified subunits

    • Compare reconstitution efficiency between wild-type and mutant components

  • Thermal Stability Assays:

    • Use differential scanning calorimetry or thermal shift assays to compare stability

    • Unstable but assembled complexes may indicate proper assembly but compromised function

When evaluating nqrC mutations, researchers should consider the observation that the double mutant NqrB-T236Y/NqrC-T225Y can still assemble the complex, albeit at reduced levels (10-20% of wild type) , suggesting that covalent FMN binding is not absolutely required for assembly but significantly impacts stability and yield.

What strategies can resolve inconsistent results in Na+ transport assays with recombinant nqrC?

Inconsistent results in Na+ transport assays can arise from multiple sources. The following strategies can help resolve these issues:

  • Standardize Membrane Vesicle Preparation:

    • Ensure consistent inside-out or right-side-out orientation of membrane vesicles

    • Standardize vesicle size through extrusion techniques

    • Verify protein:lipid ratios across preparations

  • Control for Background Transport Activities:

    • Include inhibitor controls specific for Na+-NQR

    • Measure transport in membrane preparations from cells lacking the Na+-NQR complex

    • Assess contribution of other Na+ transport systems that may be present

  • Validate Ion-Specific Indicators:

    • Calibrate fluorescent Na+ indicators under experimental conditions

    • Verify response ranges are appropriate for expected Na+ concentration changes

    • Control for potential interference from other ions or buffer components

  • Address Technical Variability:

    • Implement internal standards for normalization across experiments

    • Use automated systems where possible to reduce operator variability

    • Develop quality control metrics for accepting or rejecting individual measurements

  • Systematic Environmental Testing:

    • Systematically vary pH, temperature, and ionic composition

    • Identify conditions where results are most reproducible

    • Determine whether inconsistencies follow specific patterns related to these variables

When comparing results across different studies, researchers should carefully consider that the functionality of Na+-NQR depends on large conformational changes coupling electron transfer to ion translocation . Subtle differences in experimental conditions may affect these conformational dynamics, leading to apparently inconsistent results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.