Recombinant Vibrio anguillarum Na (+)-translocating NADH-quinone reductase subunit D (nqrD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its use.
Synonyms
nqrD; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Vibrio anguillarum (Listonella anguillarum)
Target Names
nqrD
Target Protein Sequence
MSSAKEIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTAFSNLFVS LIRHHIPNSVRIIVQMAIIASLVIVVDQILRAYLYDISKQLSVFVGLIITNCIVMGRAEA FAMKSAPIPSFIDGIGNGLGYGFVLITVGFFRELLGSGKLFGMEVLPLVKDGGWYQPNGL MLLAPSAFFLIGFMIWAIRTFKPEQLEAKE
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase complex and what role does NqrD play?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) is a membrane-associated respiratory complex found in various bacteria including Vibrio species. This enzyme complex consists of six subunits (NqrA through NqrF) and functions as a primary sodium pump, coupling the oxidation of NADH to quinone reduction while translocating sodium ions across the bacterial membrane. The complex generates both a sodium gradient and electrical potential (ΔΨ) across the membrane, which can be utilized for various cellular processes including flagellar rotation, nutrient uptake, and detoxification . NqrD is one of the integral membrane subunits of this complex that likely participates in the sodium translocation pathway, though its exact mechanistic role remains an area of active investigation. The enzyme demonstrates high specific activity in the presence of sodium, with studies on related Vibrio species showing NADH consumption at a turnover number of approximately 720 electrons per second . Understanding the structure-function relationship of NqrD is crucial for elucidating the complete mechanism of this sophisticated molecular machine that converts chemical energy to an electrochemical gradient.

What is the relationship between the Na+-NQR complex and virulence in Vibrio anguillarum?

The relationship between the Na+-NQR complex and virulence in Vibrio anguillarum is multifaceted and involves both direct and indirect mechanisms. While the primary role of the Na+-NQR complex is in energy metabolism, the sodium motive force it generates supports numerous cellular processes that contribute to pathogenicity. V. anguillarum is primarily known as a marine fish pathogen causing vibriosis, a terminal hemorrhagic septicemia in various fish species worldwide, though rare human infections have been reported . The virulence of V. anguillarum has traditionally been attributed to factors such as the pJM1-like plasmid encoding an iron uptake system, various hemolysins (VAH1-5), metalloproteases (EmpA), and quorum sensing mechanisms . Under starvation conditions, which bacteria may encounter during infection, V. anguillarum maintains expression of virulence genes including toxR, rtxA, and various virulence regulators . The Na+-NQR complex may indirectly support virulence by providing the energy required for the expression and function of these virulence factors. Additionally, the sodium gradient established by Na+-NQR could be crucial for the rotation of flagella, allowing bacterial motility and invasion. Understanding the precise contribution of NqrD and the entire Na+-NQR complex to virulence mechanisms could potentially inform new therapeutic strategies against vibriosis in aquaculture and the rare but potentially severe human infections.

What are the optimal expression systems for producing recombinant V. anguillarum NqrD?

The optimal expression systems for producing recombinant V. anguillarum NqrD must balance authentic membrane protein folding with sufficient yield for downstream applications. Based on successful approaches with related Vibrio species, homologous expression in V. anguillarum itself or closely related Vibrio species provides the most authentic environment for proper folding and assembly of membrane proteins like NqrD. Research on V. cholerae has demonstrated that the entire nqr operon can be effectively expressed under the regulation of the PBAD promoter within the native organism . This approach allows for controlled expression and proper assembly of the complete Na+-NQR complex. For isolated expression of NqrD, a similar strategy could be employed with the NqrD gene alone under an inducible promoter, though this may result in improper folding without its partner subunits. Alternative expression hosts include Escherichia coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which contain mutations that prevent the toxicity often associated with overexpression of membrane proteins. For V. anguillarum specifically, a plasmid-free derivative strain like MVAV6201 has shown promise as an effective delivery system for recombinant proteins, achieving secretion efficiencies of up to 300 μg/L for certain fusion proteins . When designing expression constructs, the addition of affinity tags (such as a C-terminal hexahistidine tag) facilitates downstream purification while minimally impacting protein function, as demonstrated with the NqrF subunit in V. cholerae studies .

What purification techniques preserve the structural integrity and activity of recombinant NqrD?

Preserving the structural integrity and activity of recombinant NqrD during purification requires careful consideration of detergent selection, buffer composition, and chromatographic techniques. The choice of detergent is particularly crucial for membrane proteins - studies with the Na+-NQR complex from V. cholerae demonstrated that dodecyl maltoside (DM) preserved the native ubiquinone content and functional properties better than lauryldimethylamine oxide (LDAO) . For NqrD specifically, a mild non-ionic detergent like DM or n-dodecyl-β-D-maltoside (DDM) at concentrations just above the critical micelle concentration would likely provide the best balance between protein extraction and activity preservation. Affinity chromatography using metal chelation (IMAC) with a hexahistidine-tagged construct provides an efficient first purification step, allowing for single-step purification of active enzyme from detergent-solubilized membranes . Buffer systems should maintain a pH similar to the bacterial periplasm (typically pH 7.5-8.0) and include sodium ions (typically 100-200 mM NaCl) to stabilize the protein. The addition of glycerol (10-20%) can further enhance protein stability during purification and storage. For higher purity requirements, additional chromatographic steps such as ion exchange or size exclusion chromatography may be implemented following the initial affinity purification. Throughout purification, maintaining a cold temperature (4°C) and including protease inhibitors helps prevent degradation. Activity assays tracking NADH oxidation spectrophotometrically can confirm that the purified protein maintains its native structure and function. If studying NqrD in isolation rather than as part of the complete complex, reconstitution into liposomes may be necessary to evaluate its contribution to sodium translocation.

How can researchers accurately assess the functional integrity of purified recombinant NqrD?

Researchers can assess the functional integrity of purified recombinant NqrD through a combination of biochemical, biophysical, and functional assays. Since NqrD functions as part of the larger Na+-NQR complex, its isolated activity may be limited, but several approaches can verify proper folding and potential function. Circular dichroism (CD) spectroscopy can confirm the secondary structure composition expected of a transmembrane protein with predicted alpha-helical domains. Thermal stability assays, such as differential scanning fluorimetry (DSF), can indicate whether the protein is properly folded by measuring its melting temperature. For functional assessment, reconstitution into proteoliposomes allows evaluation of sodium transport activity when combined with other subunits of the complex. Sodium transport can be monitored using fluorescent indicators such as SBFI (sodium-binding benzofuran isophthalate) or radioactive 22Na+ to measure sodium accumulation inside vesicles. The complete Na+-NQR complex typically exhibits a 5-fold stimulation of activity in the presence of sodium and generates both a sodium gradient and electrical potential across membranes . If studying NqrD in the context of the complete complex, NADH oxidation activity can be measured spectrophotometrically by monitoring the decrease in absorbance at 340 nm, with expected turnover numbers around 720 electrons per second in optimal conditions . Additionally, binding assays with quinone analogs using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can provide insights into NqrD's potential role in quinone binding. Maintaining appropriate detergent conditions throughout these analyses is critical, as the choice of detergent significantly impacts both structure and function—dodecyl maltoside has been shown to better preserve native quinone content compared to other detergents like LDAO .

What role does the NqrD subunit play in sodium ion translocation mechanisms?

The NqrD subunit likely plays a crucial role in the sodium ion translocation mechanism of the Na+-NQR complex, though the precise molecular details remain to be fully elucidated. As one of the integral membrane subunits, NqrD is positioned to participate in forming the transmembrane channel or pathway through which sodium ions are pumped. The Na+-NQR complex is known to function as a primary sodium pump that couples the exergonic redox reaction between NADH and ubiquinone to the endergonic translocation of sodium ions against their concentration gradient . This process generates both a sodium gradient and an electrical potential (ΔΨ) across the membrane, which has been demonstrated through reconstitution experiments with the purified complex . Structural predictions suggest that NqrD contains multiple transmembrane alpha-helices that could line a sodium ion channel. Key acidic residues (aspartate or glutamate) within these transmembrane segments might serve as temporary binding sites for sodium ions during translocation. The sequential binding and release of sodium ions, coordinated with electron transfer events through the complex, could constitute the molecular mechanism of ion pumping. The activity of the Na+-NQR complex is stimulated up to 5-fold by sodium ions , suggesting allosteric regulation that might involve conformational changes in subunits like NqrD. Advanced techniques such as cryo-electron microscopy of the complete complex, coupled with site-directed mutagenesis and functional assays specifically targeting NqrD, would be necessary to fully characterize its role in the sodium translocation mechanism.

How do variations in NqrD sequence and structure across different Vibrio species correlate with functional differences?

Variations in NqrD sequence and structure across different Vibrio species likely correlate with functional adaptations to diverse ecological niches and metabolic requirements. Vibrio species inhabit various environments from marine and estuarine waters to host organisms, each presenting unique challenges for energy metabolism and sodium homeostasis. Comparative genomic analysis of nqrD sequences from V. anguillarum, V. cholerae, and other Vibrio species could reveal conserved regions essential for core functions versus variable regions that might confer species-specific adaptations. For instance, V. anguillarum, as a marine fish pathogen , may have evolved specific features in NqrD to optimize function at the higher sodium concentrations found in seawater compared to V. cholerae, which can thrive in both marine environments and the human intestine. The Na+-NQR complex demonstrates sodium-dependent stimulation , and variations in the sodium binding sites potentially involving NqrD might reflect adaptations to different sodium concentration ranges. Furthermore, as these bacteria face different energy demands and utilize different carbon sources in their respective niches, adaptations in the coupling efficiency between NADH oxidation and sodium translocation might be reflected in NqrD sequence variations. Structural biology approaches combined with functional assays comparing recombinant NqrD from different Vibrio species could establish structure-function relationships. Additionally, domain swapping experiments, where regions of NqrD from one species are replaced with corresponding regions from another species, could identify the specific sequence elements responsible for functional differences. Such comparative studies would not only enhance our understanding of bacterial energy metabolism adaptation but might also reveal insights into the evolution of ion-translocating membrane proteins.

How does the Na+-NQR complex contribute to V. anguillarum survival under starvation conditions?

The Na+-NQR complex likely plays a critical role in V. anguillarum survival under starvation conditions by maintaining essential energy metabolism and homeostatic functions. V. anguillarum has demonstrated remarkable ability to remain culturable after 6 months of starvation while maintaining virulence factors and pathogenicity . This persistence suggests sophisticated metabolic adaptation mechanisms in which the Na+-NQR complex may be central. As the primary respiratory enzyme coupling NADH oxidation to sodium translocation, the Na+-NQR complex generates both a sodium gradient and membrane potential that can drive numerous cellular processes even under nutrient limitation . Under starvation, bacteria typically downregulate energy-intensive processes while maintaining minimal essential functions. Transcriptomic analyses of starved V. anguillarum have revealed complex regulation patterns of various genes , and it would be valuable to examine whether nqrD and other Na+-NQR components are differentially regulated during starvation. The sodium motive force generated by Na+-NQR could power high-affinity nutrient transport systems that become crucial when nutrients are scarce. Additionally, Na+-NQR might contribute to maintaining internal pH and ion homeostasis under stress conditions, which is essential for protein function and cell survival. The energy efficiency of the Na+-NQR complex—specifically how many sodium ions are translocated per NADH oxidized—could be a critical factor in starvation survival. Furthermore, given that starved V. anguillarum cells maintain virulence-related genes including toxR and various colonization factors , the energy provided by Na+-NQR might be preferentially allocated to sustain these virulence mechanisms even under nutrient limitation, contributing to the bacterium's persistent pathogenicity in aquaculture environments.

Could the NqrD subunit serve as a potential target for anti-Vibrio therapeutics?

The NqrD subunit presents a promising target for anti-Vibrio therapeutics due to its essential role in energy metabolism and potentially unique structural features. As an integral component of the Na+-NQR complex, which functions as the primary respiratory enzyme in many marine bacteria including Vibrio species, NqrD is likely essential for bacterial growth and survival. Inhibition of the Na+-NQR complex would disrupt the sodium gradient that powers numerous cellular processes, potentially leading to bacterial death or significant growth impairment. Several features make NqrD particularly attractive as a drug target: it is absent in mammals (which use H+-translocating respiratory complexes instead), reducing the risk of off-target effects; it is accessible from the periplasmic side of the bacterial membrane; and it likely contains specific binding sites involved in sodium translocation that could be targeted by small-molecule inhibitors. For aquaculture applications, where V. anguillarum causes devastating vibriosis in fish populations worldwide , NqrD-targeted therapeutics could offer a specific treatment with potentially minimal environmental impact compared to broad-spectrum antibiotics. The development of such inhibitors would require detailed structural characterization of NqrD, which could be achieved through techniques such as cryo-electron microscopy of the complete Na+-NQR complex or NMR studies of isolated domains. Structure-based drug design approaches could then identify molecules that bind specifically to critical regions of NqrD. Given that V. anguillarum can maintain virulence factors even under starvation conditions , targeting the energy-generating capabilities through NqrD inhibition might be particularly effective against persistent forms of the bacterium that conventional antibiotics struggle to eliminate. Furthermore, since Na+-NQR inhibition would target a different cellular pathway than traditional antibiotics, such therapeutics might be effective against antibiotic-resistant strains.

How might environmental factors affect the expression and function of NqrD in V. anguillarum?

Environmental factors likely exert significant influences on the expression and function of NqrD in V. anguillarum through complex regulatory networks that respond to changing conditions. As a marine bacterium that can survive in diverse environments from open water to fish tissues, V. anguillarum encounters variations in salinity, temperature, pH, nutrient availability, and oxygen levels that may all impact NqrD expression and function. Sodium concentration is particularly relevant given that Na+-NQR activity is stimulated up to 5-fold by sodium ions . In high-sodium environments like seawater, increased expression or activity of the Na+-NQR complex might be advantageous for maintaining sodium homeostasis and generating energy. Temperature fluctuations affect membrane fluidity, which could influence the function of membrane-embedded proteins like NqrD. V. anguillarum must adapt to temperature differences between the external environment and host organisms during infection, potentially requiring adjustments in Na+-NQR composition or activity. Oxygen availability also likely impacts NqrD expression, as the Na+-NQR complex functions in aerobic respiration but may be differentially regulated under microaerobic conditions that might be encountered during infection or in sediments. Under starvation conditions, V. anguillarum demonstrates sophisticated survival strategies while maintaining virulence factors , suggesting that NqrD and other components of primary metabolism might be regulated as part of a coordinated stress response. The regulatory network controlling nqrD expression likely involves multiple factors including the virulence regulator ToxR, which has been identified in V. anguillarum . Quorum sensing systems, which V. anguillarum employs through the production of N-acylhomoserine lactones , might also influence Na+-NQR expression as part of population-density-dependent metabolic adjustments. Understanding these complex regulatory mechanisms could provide insights into how V. anguillarum adapts its energy metabolism to thrive in changing environments and maintain pathogenicity.

What are the common challenges in expressing recombinant NqrD and how can they be overcome?

Common challenges in expressing recombinant NqrD stem primarily from its nature as an integral membrane protein, which presents multiple obstacles throughout the expression and purification process. Toxicity to host cells is a frequent issue, as overexpression of membrane proteins can disrupt membrane integrity and overwhelm the cell's protein insertion machinery. This can be addressed by using specialized expression strains, such as C41(DE3) or C43(DE3) for E. coli-based expression, or by employing tightly regulated inducible promoters like the PBAD system that has been successful for Na+-NQR expression in V. cholerae . Low expression yields represent another common challenge, often necessitating optimization of growth conditions including temperature, induction timing, and inducer concentration—typically, lower temperatures (16-20°C) and longer expression times favor proper folding of membrane proteins over inclusion body formation. Improper folding or aggregation can occur when the protein fails to integrate correctly into the membrane, potentially requiring the co-expression of chaperones or fusion with solubility-enhancing tags. The most effective approach might be homologous expression within V. anguillarum itself or closely related Vibrio species, as demonstrated with the plasmid-free V. anguillarum strain MVAV6201 which has successfully expressed recombinant proteins with secretion efficiencies of up to 300 μg/L . When expressing NqrD in isolation rather than as part of the complete Na+-NQR complex, stability issues may arise due to the absence of stabilizing interactions with partner subunits, potentially requiring the addition of lipids or specific detergents to the growth medium. For purification, selecting the appropriate detergent is crucial—dodecyl maltoside (DM) has been shown to better preserve the native properties of the Na+-NQR complex compared to detergents like LDAO . Additionally, incorporating affinity tags positioned to avoid interference with protein folding or function facilitates purification while maintaining structural integrity.

What are the most significant research gaps in our understanding of NqrD structure and function?

The most significant research gaps in our understanding of NqrD structure and function center around the lack of high-resolution structural data and incomplete characterization of its precise role in sodium translocation. Despite advances in membrane protein structural biology, no atomic-resolution structure exists specifically for the NqrD subunit from V. anguillarum or its homologs in related species. This structural deficit limits our understanding of how NqrD contributes to the Na+-NQR complex architecture and function. The exact pathway for sodium translocation through the complex remains undetermined, including which residues in NqrD participate in sodium binding and transport. Another significant gap involves the lack of comprehensive mutagenesis studies specifically targeting NqrD to identify critical functional residues and domains. The molecular mechanism coupling electron transfer to sodium pumping is not fully understood, particularly how energy from the redox reactions is transduced to drive ion movement against a concentration gradient. Additionally, little is known about potential regulatory mechanisms that might modulate NqrD function in response to changing environmental conditions, which is particularly relevant for V. anguillarum as it transitions between different environments during infection cycles. The relationship between NqrD/Na+-NQR activity and virulence mechanisms in V. anguillarum requires further investigation, especially considering that the bacterium maintains virulence factors during extended starvation . Comparative studies examining sequence and functional variations in NqrD across different Vibrio species could provide evolutionary insights but remain largely unexplored. Furthermore, the potential of NqrD as a therapeutic target lacks substantial investigation despite its essential role in bacterial energy metabolism and absence in mammalian systems. These knowledge gaps present significant opportunities for researchers to advance our understanding of bacterial energy metabolism, ion translocation mechanisms, and potential antimicrobial strategies targeting NqrD and the Na+-NQR complex.

How might future technological advances enhance our ability to study and manipulate NqrD?

Future technological advances across multiple disciplines will significantly enhance our ability to study and manipulate NqrD, potentially resolving current research limitations. In structural biology, advancements in cryo-electron microscopy, particularly the development of improved detectors and processing algorithms, will enable atomic-resolution structures of membrane protein complexes like Na+-NQR without the need for crystallization. This will reveal the precise positioning of NqrD within the complex and its interactions with other subunits. Complementary approaches such as hydrogen-deuterium exchange mass spectrometry and solid-state NMR tailored for membrane proteins will provide dynamic structural information about conformational changes during the catalytic cycle. Genetic engineering advances, particularly refinements in CRISPR-Cas systems optimized for bacteria, will enable more precise genome editing in V. anguillarum to create conditional knockdowns or introduce specific mutations in nqrD with minimal off-target effects. Synthetic biology approaches might allow the creation of minimal Na+-NQR systems with simplified components to isolate and study NqrD function. Improvements in membrane protein expression and purification technologies, including novel detergents, nanodiscs, and polymer-based systems like styrene-maleic acid lipid particles (SMALPs), will enhance our ability to obtain functional recombinant NqrD for biochemical and structural studies. Advanced computational methods, including molecular dynamics simulations with improved force fields for membrane environments, will model sodium ion movement through the complex and predict critical residues in NqrD involved in this process. These predictions can guide targeted experimental approaches. Real-time imaging techniques such as high-speed atomic force microscopy might capture conformational dynamics of the Na+-NQR complex during activity. For functional studies, development of more sensitive ion-specific fluorescent probes and electrophysiological approaches adapted for bacterial membrane proteins will allow better characterization of sodium translocation mechanisms. Looking toward applications, advances in drug delivery systems and antimicrobial development, including fragment-based drug discovery approaches specifically targeting membrane proteins, will facilitate the development of NqrD inhibitors as potential therapeutics against vibriosis in aquaculture and potentially for rare human V. anguillarum infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.