Recombinant Vibrio anguillarum Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Sodium Translocation

The Na+^+-NQR complex generates a sodium gradient (ΔμNa+\Delta \mu \text{Na}^+) using energy from NADH oxidation. Key mechanistic insights:

  • Electron Transfer Pathway: Electrons flow from NADH → FAD (NqrF) → [2Fe-2S] cluster (NqrF) → riboflavin (NqrB) → ubiquinone .

  • Sodium Binding Sites: NqrE and NqrB form a sodium channel, with conserved aspartate residues (e.g., Asp49^{49}, Asp52^{52}) critical for ion coordination .

  • Turnover Rate: The recombinant enzyme exhibits a high NADH oxidation rate of 720 electrons/second in sodium-rich environments .

Antibiotic Target Potential

Na+^+-NQR is absent in eukaryotes, making it a promising target for novel antibiotics. Inhibitors like aurachins and korormicin bind to NqrE-NqrB interfaces, blocking quinone reduction and sodium pumping . Structural studies show these inhibitors interfere with:

  • Ubiquinone binding at the NqrA-NqrB interface.

  • Conformational flexibility required for electron-proton coupling .

Recombinant Applications

The His-tagged recombinant NqrE is used to:

  • Study enzyme assembly and mutagenesis in V. anguillarum.

  • Screen inhibitors targeting Na+^+-NQR’s sodium translocation mechanism .

Comparative Genomic Insights

The nqr operon is conserved in pathogenic Vibrio species, including V. anguillarum 775 (KEGG: T01536) . Key genomic features:

  • Operon Structure: nqrA-nqrB-nqrC-nqrD-nqrE-nqrF.

  • Regulation: Expression is upregulated under iron-limited conditions, linking it to virulence in fish hosts .

Research Challenges and Future Directions

  • Structural Biology: No high-resolution structure of V. anguillarum Na+^+-NQR exists. Cryo-EM studies of homologs (e.g., V. cholerae) suggest dynamic conformational changes during catalysis .

  • Pathogenicity Link: While Na+^+-NQR is essential for energy metabolism, its direct role in V. anguillarum virulence remains unexplored. Contrastingly, siderophore systems (e.g., piscibactin) dominate virulence studies .

Key Research Findings

StudyKey Contribution
Inhibitor binding (PMC7476727) Identified NqrE-NqrB interface as a target for blocking quinone reduction.
Enzyme reconstitution Demonstrated Na+^+-NQR generates ΔΨ\Delta \Psi and ΔNa+\Delta \text{Na}^+ in liposomes.
Genetic diversity analysis Highlighted conserved nqr operon across V. anguillarum serotypes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio anguillarum (Listonella anguillarum)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVRSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVTVVLTISVPVNNLVY NLLLKPGALGENIDLTFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITAGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does nqrE contribute to bacterial physiology and pathogenesis?

The nqrE subunit, as part of the NQR complex, participates in energy conservation by coupling NADH oxidation to the generation of a sodium ion gradient across the bacterial membrane. This process is particularly important in Vibrio species, which often inhabit marine environments where sodium ions are abundant.

In pathogenic contexts, the NQR complex may contribute to Vibrio anguillarum's ability to cause vibriosis in marine fish. While not directly mentioned among the virulence factors tested in transcriptomic studies, the energy metabolism provided by properly functioning NQR may support various virulence mechanisms . The relationship between energy metabolism and virulence is becoming increasingly recognized in bacterial pathogens, where the ability to adapt to host environments often depends on flexible bioenergetic systems.

Research has shown that when V. anguillarum is subjected to starvation stress (a condition often encountered during infection), significant changes occur in gene expression patterns related to energy metabolism, which may include modulation of NQR components .

What expression systems are suitable for recombinant production of nqrE?

When expressing membrane proteins like nqrE, choosing an appropriate expression system is critical. For Vibrio proteins, the following approaches have proven effective:

  • Vibrio natriegens as an expression host: This non-pathogenic and fast-growing Vibrio species has been demonstrated as an excellent host for expressing membrane proteins from other Vibrio species. Studies have shown successful heterologous expression of the NQR complex from Vibrio cholerae in V. natriegens, resulting in functional protein assembly .

  • E. coli-based systems: While traditional E. coli systems can be used, they often face challenges with membrane protein insertion and complete assembly of multisubunit complexes from Vibrio species. If using E. coli, specialized strains designed for membrane protein expression may improve yields .

Expression HostAdvantagesLimitations
V. natriegens- Native-like membrane environment
- Rapid growth
- Complete complex assembly
- Non-pathogenic
- Less established genetic tools
- May require optimization
E. coli- Well-established protocols
- Extensive genetic tools
- Higher yields for soluble domains
- May lack specific accessory genes
- Incomplete complex assembly
- Different membrane composition

For optimal results with Vibrio membrane proteins, V. natriegens offers significant advantages as it provides a more suitable membrane environment and cellular machinery for proper protein folding and assembly .

How can researchers verify proper expression and function of recombinant nqrE?

Verification of proper nqrE expression and function requires multiple analytical approaches:

  • Blue Native PAGE (BN-PAGE) with activity staining: This technique allows visualization of the assembled NQR complex and can confirm whether recombinant nqrE has incorporated into the functional complex. Activity staining can verify enzymatic function directly in the gel .

  • NADH:quinone oxidoreduction activity assays: Membrane fractions containing expressed NQR complex should display increased NADH:quinone oxidoreduction activity compared to control membranes. This can be measured spectrophotometrically by monitoring NADH oxidation .

  • Inhibitor sensitivity testing: NQR activity is specifically inhibited by Ag+ ions. Demonstrating that the recombinant protein activity is sensitive to this inhibitor provides strong evidence of proper functional assembly .

  • Quantitative RT-PCR: To verify expression at the mRNA level, qRT-PCR can be used to compare transcript levels before and after induction, using primers specific to the nqrE gene .

For confirmation of proper complex assembly, researchers should aim to demonstrate both the presence of the protein (via immunoblotting or mass spectrometry) and its functional activity (via enzymatic assays).

What are the optimal conditions for storing and handling recombinant nqrE protein?

Proper storage and handling are crucial for maintaining the activity of recombinant membrane proteins like nqrE:

  • Storage temperature: Store the purified protein at -20°C for routine use, or at -80°C for extended storage periods .

  • Buffer composition: A Tris-based buffer containing 50% glycerol optimized for this specific protein is recommended. The specific buffer composition may need to be determined empirically for each preparation .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as it can denature membrane proteins. Prepare working aliquots that can be stored at 4°C for up to one week .

  • Detergent considerations: As nqrE is a membrane protein, appropriate detergents must be included in all buffers after extraction from the membrane. The choice of detergent significantly impacts protein stability and activity.

Researchers should carefully validate storage conditions for their specific nqrE preparation, as variations in purification method, buffer composition, and detergent choice can all affect protein stability.

How can recombinant nqrE be used to study Vibrio anguillarum pathogenesis?

Recombinant nqrE can be employed in several advanced research strategies to understand V. anguillarum pathogenesis:

  • Gene knockout studies: Constructing nqrE knockout mutants using marker exchange techniques similar to those employed for recA mutation in V. anguillarum can help determine the contribution of this gene to virulence. This involves inserting an antibiotic resistance gene into nqrE and introducing this construct into V. anguillarum via conjugal mobilization .

  • Transcriptomic analysis: Comparing gene expression profiles between wild-type and nqrE mutant strains under various conditions (including starvation stress) can reveal how this gene influences global gene expression patterns, particularly those related to virulence factors. RNA sequencing followed by differential expression analysis can identify genes co-regulated with nqrE .

  • Survival assays under environmental stress: Since V. anguillarum must adapt to diverse environments during infection, testing how nqrE mutations affect bacterial survival under starvation, pH stress, or oxidative stress can provide insights into its role in pathogenesis .

  • Host infection models: Using established fish infection models, researchers can compare the virulence of wild-type and nqrE-modified strains to directly assess its contribution to pathogenesis.

When designing these experiments, researchers should include appropriate controls and consider complementation studies (reintroducing functional nqrE) to confirm that any observed phenotypes are specifically due to nqrE modification.

What structural analysis techniques are most effective for studying nqrE?

Understanding the structural features of nqrE is challenging due to its membrane-embedded nature, but several techniques can provide valuable insights:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and can provide high-resolution structures of the entire NQR complex, including the nqrE subunit in its native conformation.

  • X-ray crystallography: While challenging for membrane proteins, crystallography can yield high-resolution structural data if the protein can be successfully crystallized, often requiring extensive optimization of detergent and crystallization conditions.

  • NMR spectroscopy: For specific domains or smaller regions of nqrE, solution or solid-state NMR can provide detailed structural information, particularly about dynamic regions.

  • Molecular dynamics simulations: Computational approaches can model nqrE structure within a lipid bilayer environment, predicting how the protein interacts with other subunits and responds to sodium ion gradients.

  • Cross-linking mass spectrometry: This approach can identify interaction points between nqrE and other NQR subunits, helping to build structural models of the full complex.

Each of these techniques has specific sample preparation requirements, and researchers often need to combine multiple approaches to build a comprehensive structural understanding of membrane proteins like nqrE.

How to resolve contradictory findings between different experimental approaches?

When faced with contradictory results when studying nqrE, researchers should adopt a systematic troubleshooting approach:

  • Validate methodological assumptions: Different experimental techniques have inherent biases. For instance, quantitative approaches may provide statistical significance but miss mechanistic details, while qualitative approaches may reveal mechanisms but lack statistical power .

  • Consider experimental contexts: Contradictions may arise from differences in experimental conditions. The activity of membrane proteins like nqrE is highly dependent on lipid environment, pH, salt concentration, and temperature.

  • Reconcile in vitro versus in vivo findings: Results from purified recombinant nqrE may differ from those observed in whole cells due to the complex interactions within the membrane environment. Both perspectives provide valuable but different insights .

  • Use orthogonal techniques: When contradictions arise, employ methodologically distinct approaches to test the same hypothesis. For example, if biochemical assays and genetic studies give different results regarding nqrE function, add structural studies or computational modeling as a third perspective.

  • Consider methodological limitations: Each research method has blind spots. For instance, transcriptomic analysis may show changes in nqrE expression, but protein levels might remain constant due to post-transcriptional regulation .

As George Silverman notes, "When quantitative findings seem to contradict qualitative findings, which should you believe? Often, the automatic assumption is that the quantitative findings must be right... Neither stand is necessarily correct. Qualitative research and quantitative research complement each other."

What are common challenges in expressing functional nqrE and how can they be overcome?

Expression of functional membrane proteins like nqrE presents several common challenges:

  • Protein aggregation: Membrane proteins often aggregate when overexpressed. To address this:

    • Reduce expression temperature (16-20°C)

    • Use milder induction conditions

    • Include specific lipids in the growth medium

    • Express with fusion partners that enhance solubility

  • Incomplete complex assembly: As nqrE functions as part of a multisubunit complex, expressing it alone may result in non-functional protein. Consider:

    • Co-expressing multiple NQR subunits simultaneously

    • Using expression hosts like V. natriegens that have compatible assembly machinery

    • Including specific chaperones that assist in complex assembly

  • Post-translational modifications: If nqrE requires specific modifications, ensure your expression system can perform these. V. natriegens is advantageous for expressing Vibrio proteins as it likely possesses the necessary modification enzymes .

  • Cofactor incorporation: The NQR complex contains multiple cofactors. If these are not properly incorporated during expression, the resulting protein may be inactive. Supplementing growth media with cofactor precursors may improve functional yields.

  • Detergent selection: The choice of detergent for extraction and purification critically affects protein stability and activity. Screen multiple detergents and use functional assays to identify optimal conditions.

By carefully optimizing these parameters, researchers can significantly improve the yield of functional recombinant nqrE.

How to analyze transcriptomic data related to nqrE expression?

When analyzing transcriptomic data for nqrE and related genes, follow these methodological steps:

  • Quality control and normalization: Begin with standard RNA-seq quality control steps, including adapter trimming, quality filtering, and appropriate normalization methods to account for sequencing depth differences.

  • Differential expression analysis: Use tools like DESeq2 or edgeR to identify differentially expressed genes between experimental conditions. Pay particular attention to nqrE and other NQR complex subunits, as well as genes involved in energy metabolism and virulence .

  • Validation with qRT-PCR: Confirm key transcriptomic findings with qRT-PCR, especially for nqrE and related genes. This provides technical validation of RNA-seq results, as demonstrated in studies of V. anguillarum under starvation stress .

  • Pathway and network analysis: Place nqrE expression changes in the context of broader metabolic and virulence pathways. Tools like KEGG pathway analysis can identify enriched biological processes.

  • Comparative analysis across conditions: Compare nqrE expression patterns across multiple experimental conditions to identify specific triggers for upregulation or downregulation.

  • Integration with other data types: Combine transcriptomic data with proteomic, metabolomic, or phenotypic data to build a comprehensive understanding of nqrE's role in cellular processes.

When interpreting results, be aware that transcriptomic changes don't always translate to protein-level changes, and validation at the protein and functional levels is advisable for key findings.

What statistical approaches are most appropriate for analyzing nqrE activity data?

When analyzing enzymatic activity data for recombinant nqrE or NQR complex:

  • Enzyme kinetics modeling: For NADH:quinone oxidoreductase activity, use appropriate enzyme kinetic models (Michaelis-Menten, allosteric, or more complex models as needed) to determine parameters like Km, Vmax, and inhibition constants.

  • Reproducibility analysis: Biological processes involving membrane proteins often show higher variability than soluble enzymes. Use appropriate statistical tests that account for this variability, and report both technical and biological replicates.

  • Inhibitor studies analysis: When using specific inhibitors like Ag+, employ dose-response curve analysis to determine IC50 values and inhibition mechanisms .

  • Comparative statistical approaches: When comparing wild-type versus mutant nqrE activity, use appropriate statistical tests (t-tests for simple comparisons, ANOVA for multiple conditions) with corrections for multiple testing when applicable.

  • Time-series analysis: For activity measurements over time (such as monitoring NADH oxidation), consider time-series analytical approaches rather than single timepoint comparisons.

When analyzing data from membrane proteins like nqrE, be particularly mindful of the effects of experimental conditions (detergent concentration, lipid composition, temperature, pH) on activity measurements, and include appropriate controls for these variables.

What emerging technologies might advance our understanding of nqrE function?

Several cutting-edge technologies show promise for deepening our understanding of nqrE:

  • Cryo-EM advances: Ongoing improvements in cryo-EM resolution may soon allow visualization of ion translocation mechanisms in the NQR complex at an atomic level, providing unprecedented insights into how nqrE contributes to sodium pumping.

  • Nanodiscs and synthetic membranes: These technologies provide more native-like environments for studying membrane proteins compared to detergent solubilization, potentially revealing functional aspects of nqrE that are lost in traditional preparations.

  • Single-molecule techniques: Approaches like single-molecule FRET could reveal dynamic conformational changes in nqrE during catalysis, providing mechanistic insights difficult to obtain from bulk measurements.

  • Genome editing advances: CRISPR-Cas systems optimized for Vibrio species would facilitate more precise genetic manipulation of nqrE, enabling detailed structure-function studies through targeted mutations.

  • Systems biology approaches: Integration of multi-omics data (transcriptomics, proteomics, metabolomics) can place nqrE function in the broader context of cellular adaptation to different environments, particularly during host-pathogen interactions.

  • Microfluidic approaches: These technologies allow real-time monitoring of bacterial responses to changing environments, potentially revealing how nqrE activity adapts to different conditions relevant to pathogenesis.

By leveraging these emerging technologies, researchers can address fundamental questions about nqrE's role in bacterial bioenergetics and Vibrio anguillarum pathogenesis that remain unanswered with current methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.