Recombinant Vibrio cholerae serotype O1 Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lnt; VC_0958; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-505
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
lnt
Target Protein Sequence
MNSVLSHRLMRPLAAAFVGVITPLAFAPYQFWPLALLSPFILLLLLHQQSAKRAALIAYL WGIGQFAVGISWVHVSIDTFGGMPKIASLFLMTLLVGYLALYPSLFGWLLNRLFPNNSRS KWLCAAPALWLITDWLRGWVMTGFPWLWLGYSQIDSPLANFAPIGGVELITLLLLFCAGS LAYAVLNRRWLMACIPLVVYATGYGLQAMQWVTPQTERTASLALIQGNIEQGLKWLPSQR WPTIMKYTDLTRENWDADVIIWPEAAIPAFEYEISSFLHNLDAAARMNQSAVITGIINQS DDKQYFNSVLTVGDTPHGEYRYDLTQRYHKYHLLPFGEFVPFEEILRPLAPFFNLPMSSF SQGAYVQPNLIAKGFAFVTALCYEIIFNEQVRDNVTPDTDFLLTLSNDAWFGRSIGPLQH MEIARMRALELGKPLIRATNNGVTAVTDERGRIMAQLPQFETGVLKATVTPTRGSTPYFL WGTTPLYLWVGLAAGFAFWRQRRAR
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links

KEGG: vch:VC0958

STRING: 243277.VC0958

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its role in Vibrio cholerae?

Apolipoprotein N-acyltransferase (Lnt) is an essential membrane-bound enzyme that catalyzes the final step in lipoprotein processing in Gram-negative bacteria. In Vibrio cholerae, Lnt is responsible for the N-acylation of apolipoproteins, transferring an acyl group from a phospholipid to the N-terminal cysteine residue of apolipoproteins, resulting in mature triacylated lipoproteins . This process is critical for proper lipoprotein localization and function, which in turn affects bacterial membrane integrity, cell division, and pathogenesis. The enzyme is encoded by the lnt gene (VC_0958) in V. cholerae .

Lnt functions as part of a three-step lipoprotein processing pathway in which:

  • The cysteine that becomes the N-terminal amino acid of the mature lipoprotein receives a diacylglyceryl group from phosphatidylglycerol through the action of Lgt

  • The amino-terminal signal peptide is processed by prolipoprotein signal peptidase (LspA)

  • The N-terminal glyceride-cysteine residue is acylated by Lnt, completing the maturation process

How does the structure of V. cholerae Lnt compare to other bacterial Lnt proteins?

V. cholerae Lnt shares structural similarities with other bacterial Lnt proteins, particularly those from proteobacteria. The protein contains multiple transmembrane domains at its N-terminus, followed by a periplasmic domain that houses the catalytic machinery. Based on sequence conservation and structural modeling derived from related proteins, V. cholerae Lnt likely belongs to the CN hydrolase family of enzymes .

The functional domains include:

  • N-terminal transmembrane helices that anchor the protein in the cytoplasmic membrane

  • A hydrophobic pocket that constitutes the active site

  • Flexible arms that are thought to open and close upon binding and release of substrates (phospholipids and apolipoproteins)

Essential residues identified in E. coli Lnt are conserved in V. cholerae and other proteobacterial Lnt proteins, suggesting a conserved catalytic mechanism. These include the potential catalytic triad E267-K335-C387 (using E. coli numbering), as well as residues Y388 and E389 that form part of the active site .

What are the optimal methods for expressing and purifying recombinant V. cholerae Lnt?

Recombinant V. cholerae Lnt can be expressed using various host systems, each with specific advantages depending on research objectives:

Expression Systems Comparison:

Expression SystemAdvantagesChallengesRecommended for
E. coliHigh yield, rapid growth, inexpensiveMembrane protein folding issuesInitial structural studies, antibody production
YeastPost-translational modifications, better membrane protein foldingLower yield, longer expression timeFunctional studies requiring eukaryotic modifications
BaculovirusExcellent for membrane proteins, high yieldComplex system, time-consumingHigh-resolution structural studies
Mammalian cellsNative-like post-translational modificationsLow yield, expensiveStudies requiring mammalian-like modifications

For optimal purification of V. cholerae Lnt, a multi-step approach is recommended:

  • Express the protein with an affinity tag (His-tag or FLAG-tag) for initial capture

  • Solubilize membrane fractions using appropriate detergents (DDM, LDAO, or Triton X-100)

  • Perform immobilized metal affinity chromatography (IMAC)

  • Further purify using size-exclusion chromatography (SEC)

  • Verify purity by SDS-PAGE and Western blotting using antibodies against the tag or Lnt itself

When working with V. cholerae Lnt, maintaining the protein in a stable form requires careful buffer optimization with glycerol (typically 50%) as seen in commercial preparations .

How can researchers verify the enzymatic activity of purified recombinant V. cholerae Lnt?

Verification of V. cholerae Lnt enzymatic activity requires multiple complementary approaches:

In vitro enzymatic assays:

  • Radiolabeled phospholipid transfer assay: Incubate purified Lnt with radiolabeled phospholipids and apolipoprotein substrates, then detect the transfer of radiolabeled acyl chains to the substrate

  • HPLC/Mass spectrometry-based assay: Analyze the mass shift of substrate lipoproteins before and after incubation with Lnt to detect the addition of acyl chains

  • Fluorescent reporter assay: Use fluorescently labeled substrates whose properties change upon acylation

In vivo complementation studies:
Using well-characterized Lnt mutant strains, researchers can introduce V. cholerae Lnt and assess restoration of function. This approach has been successfully used with other bacterial Lnt proteins, where the mobility of reporter lipoproteins on SDS-PAGE differentiates between diacylated and triacylated forms .

A particularly effective reporter system uses a shortened lipoprotein with C-terminal tags. When expressed in wild-type and Lnt-deficient backgrounds, the differential migration pattern on SDS-PAGE indicates the acylation state. In bacterial strains lacking Lnt, the reporter protein shows increased electrophoretic mobility consistent with diacylation rather than triacylation .

Is Lnt essential for V. cholerae survival, and how can this be experimentally determined?

While Lnt has traditionally been considered essential in most Gram-negative bacteria, including E. coli, recent research has shown that it is not essential in some Gram-negative bacteria like Francisella tularensis and Neisseria gonorrhoeae . Whether Lnt is essential in V. cholerae specifically remains an important research question.

Experimental approaches to determine essentiality:

  • Targeted gene deletion approach:

    • Attempt to create clean deletions of the lnt gene using suicide plasmids with flanking homology regions

    • Include counter-selectable markers (such as sacB) to facilitate selection of deletion mutants

    • Screen potential mutants by PCR and sequence verification

  • Conditional essentiality testing:

    • Place lnt under control of an inducible promoter

    • Deplete Lnt by removing the inducer and monitor bacterial viability

    • Compare growth curves and viability under permissive and non-permissive conditions

  • Transposon mutagenesis coupled with deep sequencing (Tn-seq):

    • Generate a saturated transposon library in V. cholerae

    • Deep sequence insertion sites to identify genes that cannot tolerate insertions (essential genes)

    • Compare insertion patterns in lnt with known essential and non-essential genes

  • Complementation studies:

    • Introduce a second copy of lnt on a plasmid before attempting to delete the chromosomal copy

    • Test for the ability to cure the complementing plasmid after chromosomal deletion

    • Use temperature-sensitive plasmids to test conditional essentiality

Given the unexpected finding that Lnt is not essential in some Gram-negative bacteria, determination of its essentiality in V. cholerae would provide valuable insights into lipoprotein processing diversity across bacterial species .

How do mutations in key residues affect V. cholerae Lnt enzyme activity?

Based on studies of E. coli Lnt, several key residues are likely critical for V. cholerae Lnt function. These include the putative catalytic triad (E267-K335-C387 in E. coli numbering) and other conserved residues involved in substrate binding and catalysis .

Impact of mutations in key residues:

Residue CategoryResidues (E. coli numbering)Predicted FunctionEffect of Mutation
Catalytic triadE267, K335, C387Direct catalysisComplete loss of activity
Active site pocketY388, E389Substrate binding/positioningSevere reduction in activity
Flexible armsW237, E343Substrate binding/releaseTemperature-dependent effects

To systematically study these residues in V. cholerae Lnt:

  • Perform sequence alignment between E. coli and V. cholerae Lnt to identify corresponding residues

  • Use site-directed mutagenesis to create alanine substitutions or other relevant mutations

  • Express and purify mutant proteins to test in vitro activity

  • Perform in vivo complementation assays to assess functional impacts

  • Use structural modeling and molecular dynamics simulations to interpret experimental results

Temperature-dependent effects observed with certain mutations suggest that some residues are important for protein stability or maintaining the proper conformation of the active site rather than directly participating in catalysis .

How has Lnt evolved across different V. cholerae strains and related Vibrio species?

Lnt is highly conserved across V. cholerae strains, reflecting its important role in lipoprotein processing. Comparative genomic analyses reveal that the lnt gene is present in all sequenced V. cholerae strains, suggesting it emerged early in Vibrio evolution.

Phylogenetic studies of Lnt across different bacterial genera indicate that proteobacterial Lnt proteins (including those from Vibrio species) form a distinct clade separate from actinomycete Lnt proteins. This divergence is functionally significant, as actinomycete Lnt proteins cannot complement E. coli Lnt deficiency, while proteobacterial Lnt proteins can cross-complement .

For V. cholerae specifically, comparative analysis across epidemic and non-epidemic strains could reveal whether selective pressure has shaped Lnt evolution during host adaptation. Systematic comparison of Lnt sequences, focusing on residues involved in substrate specificity, might identify adaptations related to different environmental niches or pathogenic potential.

What is the relationship between Lnt function and V. cholerae pathogenesis?

Proper lipoprotein processing is crucial for bacterial membrane integrity, stress responses, and host-pathogen interactions. In V. cholerae, lipoproteins contribute to multiple aspects of pathogenesis, including:

  • Maintenance of outer membrane integrity

  • Nutrient acquisition during infection

  • Resistance to host antimicrobial peptides

  • Evasion of host immune responses

  • Proper function of secretion systems

As the enzyme responsible for the final step in lipoprotein maturation, Lnt likely influences these pathogenic processes indirectly by ensuring correct lipoprotein localization and function. Perturbations in Lnt activity could therefore affect V. cholerae colonization, virulence factor secretion, and persistence in the host.

Research using Lnt mutants or conditionally depleted strains (if viable) could help elucidate specific connections between Lnt function and virulence. For example, comparing wild-type and Lnt-deficient strains in models of cholera infection could reveal whether Lnt is required for specific pathogenic processes.

Can recombinant V. cholerae Lnt be targeted for vaccine development?

Bacterial lipoproteins are strong activators of innate immunity through Toll-like receptor 2 (TLR2) signaling, making them potential vaccine components. While traditional cholera vaccines have focused on toxoid-derived immunity, which has proven insufficient for long-lasting protection , targeting conserved proteins like Lnt presents an alternative approach.

Several strategies could be explored:

  • Lnt as a direct vaccine antigen:

    • Recombinant V. cholerae Lnt could be formulated with appropriate adjuvants

    • The membrane-associated nature may require special formulation (liposomes, outer membrane vesicles)

    • Conservation across strains suggests potential for broad protection

  • Lnt-modified live attenuated vaccines:

    • If Lnt proves non-essential under certain conditions, Lnt-deficient strains could be evaluated as live attenuated vaccines

    • Modified lipoprotein processing might alter immunogenicity in beneficial ways

    • Combination with other attenuating mutations could optimize safety and efficacy

  • Lnt inhibitors as therapeutic adjuncts:

    • Small molecules targeting Lnt could attenuate V. cholerae in vivo

    • Co-administration with antibiotics might enhance clearance

    • Structure-based drug design could yield selective inhibitors

The development of recombinant DNA techniques for creating live, attenuated V. cholerae strains by deleting virulence genes has shown promise for cholera vaccine development . Similar approaches targeting Lnt or using Lnt modification could be explored.

What advantages might Lnt-based vaccines offer compared to current cholera vaccines?

Current cholera vaccines have limitations, including insufficient long-term protection. Previous studies indicate that toxoid-derived antitoxic immunity alone is insufficient for effective, long-lasting protection against cholera . Lnt-based approaches might offer several advantages:

Potential advantages of Lnt-targeted vaccination approaches:

  • Conserved target across strains: Unlike some surface antigens that vary between strains, Lnt is highly conserved, potentially offering broader protection

  • Multiple immune response activation: Targeting a protein involved in lipoprotein processing could activate both antibody and cell-mediated immunity

  • Disruption of basic bacterial physiology: Interfering with Lnt function could attenuate bacteria by affecting multiple cellular processes simultaneously

  • Novel epitopes: Lnt presents epitopes distinct from those in current vaccines, potentially overcoming limitations of existing approaches

  • Combination potential: Lnt-based components could complement existing vaccine formulations for enhanced protection

Recent advances in recombinant DNA techniques have allowed the construction of live, attenuated V. cholerae strains for vaccine development . Exploring Lnt's role in these attenuated strains might reveal new strategies for optimizing cholera vaccines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.