Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

ATP synthase subunit a is encoded by the atpB gene and forms part of the F₀ sector of the ATP synthase complex. This subunit facilitates proton translocation across the bacterial membrane, driving ATP synthesis through oxidative phosphorylation . Recombinant atpB is synthesized in heterologous systems (e.g., E. coli, mammalian cells) for structural, functional, or therapeutic research.

Expression Systems

ParameterDetailsSources
Host OrganismsE. coli (in vitro systems), Baculovirus, or mammalian cells
Protein LengthPartial (e.g., CSB-BP015070VEZ1) or full-length (e.g., CSB-CF015070VEZ)
TagsN-terminal 10xHis-tag (CSB-CF015070VEZ) or undetermined tags
Purity>85% (SDS-PAGE)

Handling Guidelines:

  • Avoid repeated freezing/thawing.

  • Reconstitute in deionized sterile water with 5–50% glycerol for long-term storage .

Functional Studies

  • ATP Synthase Dynamics: Used to study proton translocation mechanisms and energy coupling in V. cholerae .

  • Membrane Protein Structure: Serves as a model for transmembrane protein folding and stability .

Diagnostic and Therapeutic Potential

  • Antigenic Studies: Could serve as a target for serological assays, though no direct applications are documented in current literature.

  • Vaccine Development: While not directly linked to atpB, recombinant V. cholerae proteins (e.g., CTB subunit) have been engineered for vaccine strains .

Comparative Analysis of Recombinant Versions

Product CodeHost SystemTagExpression RegionSource
CSB-BP015070VEZ1BaculovirusUndeterminedPartial
CSB-CF015070VEZE. coliN-terminal 10xHisFull-length
CSB-MP002355VEYMammalianUndeterminedFull-length

Key Differences:

  • Full-Length vs. Partial: Full-length versions (e.g., CSB-CF015070VEZ) retain native functionality, while partial forms may lack critical domains .

  • Tags: His-tagged proteins (e.g., CSB-CF015070VEZ) enable efficient purification via affinity chromatography .

Unresolved Questions and Future Directions

  • Pathogenic Role: No direct evidence links atpB to V. cholerae virulence. Further studies could explore its interaction with virulence factors like TCP or CTXΦ .

  • Post-Translational Modifications: Mammalian-expressed atpB may acquire modifications absent in E. coli systems, affecting functional studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; VC_2770; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Target Names
atpB
Target Protein Sequence
MAAPGEALTPSSYITHHLTNLSTYKLGLVAEESSFWNVHIDSLFFSVLTGLIFLGVFRAV ARKATAGVPGKLQCAVEMVVEFVDKNVKDTFHGRNPLIAPLALTIFCWVFLMNLMDLVPI DFLPYPAQHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHWIMIPFNLLIEVVSLLAKPLSLGMRLFGNMFAGEVVFILCAAMLPWYLQWMGSLPWAI FHILVILIQSFVFMMLTIVYMSMAHEDNDH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: vch:VC2770

STRING: 243277.VC2770

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (atpB) in Vibrio cholerae and what is its primary function?

ATP synthase subunit a (atpB) is an essential component of the F₁F₀-type ATP synthase complex in Vibrio cholerae. This membrane-embedded protein forms part of the F₀ sector and plays a crucial role in proton translocation across the bacterial membrane. The primary function of atpB is to create a pathway for protons to pass through the membrane, contributing to the proton motive force that drives ATP synthesis. Unlike some related Vibrio species, V. cholerae F₁F₀ ATPase specifically functions as a proton (H⁺) pump rather than a sodium (Na⁺) pump, as confirmed through membrane potential and pH gradient measurements in wild-type and ΔatpE mutant studies .

The proton specificity of V. cholerae ATP synthase represents an important adaptation in its membrane bioenergetics, which utilizes both H⁺ and Na⁺ as coupling ions for various cellular processes. This characteristic distinguishes V. cholerae from some closely related bacterial species and influences its energy metabolism in different environmental conditions.

How does the ion specificity of ATP synthase in V. cholerae compare to other bacterial pathogens?

The ATP synthase in Vibrio cholerae demonstrates specific H⁺-transporting capabilities, in contrast to some other Vibrio species that were previously thought to utilize Na⁺-dependent ATP synthesis. Bioinformatic analysis based on the Na⁺-binding model developed by Rahlfs and Müller confirms this H⁺ specificity in V. cholerae . When this model is applied to AtpE sequences from various bacteria and archaea, it reveals that Na⁺-specific F₁F₀ ATPases are present in several important bacterial pathogens, highlighting the evolutionary diversity of ion-coupling mechanisms.

In V. cholerae specifically, membrane energetics involve both H⁺ and Na⁺ as coupling ions, with the Na⁺ transport being linked to virulence gene expression. While the F₁F₀ ATPase transports protons, other membrane components such as the NADH:ubiquinone oxidoreductase (NQR) serve as primary Na⁺-translocating pumps . This dual ion utilization system allows V. cholerae to adapt to various environmental conditions, including the high-sodium environment of the small intestine.

What are the recommended methods for cloning and expressing recombinant V. cholerae atpB?

For successful cloning and expression of recombinant V. cholerae atpB, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with inducible promoters such as the Escherichia coli nirB promoter, which has demonstrated high protein expression levels under low aeration conditions .

  • Cloning strategy:

    • Amplify the atpB gene from V. cholerae genomic DNA using PCR with primers containing appropriate restriction sites.

    • Digest the PCR product and expression vector with compatible restriction enzymes (such as XbaI and NdeI).

    • Ligate the digested PCR product into the prepared vector.

    • Transform the ligation mixture into an appropriate E. coli strain for plasmid amplification.

  • Expression conditions:

    • Transform the verified recombinant plasmid into an expression host.

    • Culture the transformants under low aeration conditions to maximize protein expression when using the nirB promoter.

    • Alternatively, consider using the cholera toxin gene promoter (pctx) for expression, which can be amplified using specific primers (e.g., Pct1 containing an XbaI site and Pct2 corresponding to the reverse sequence of the ctx gene with an NdeI site) .

  • Protein purification:

    • Use affinity tags (His-tag or GST-tag) for simplified purification.

    • Employ membrane protein extraction protocols optimized for ATP synthase components.

    • Utilize ultracentrifugation for membrane fraction isolation followed by detergent solubilization.

These methodological guidelines should be adapted based on specific experimental goals and available resources in the laboratory setting.

How can researchers generate and verify atpB mutants in Vibrio cholerae?

Creating and verifying atpB mutants in Vibrio cholerae requires a systematic approach:

Generation of atpB mutants:

  • Allelic exchange method:

    • Construct a suicide vector containing upstream and downstream regions of atpB flanking a selectable marker.

    • Transform into V. cholerae and select for single crossover integrants.

    • Counter-select for double crossover events resulting in gene deletion.

  • CRISPR-Cas9 approach:

    • Design guide RNAs targeting atpB.

    • Co-transform with a repair template containing homology arms.

    • Select transformants and verify deletions.

Verification strategies:

  • Genotypic verification:

    • PCR analysis using primers flanking the deletion site.

    • DNA sequencing to confirm precise deletion boundaries.

    • Southern blot analysis for complex genomic arrangements.

  • Phenotypic verification:

    • Measure membrane potential and pH gradient in isolated membrane vesicles from wild-type and mutant strains.

    • Compare ATP synthesis and hydrolysis activities in both strains.

    • Assess proton translocation capabilities as measured by fluorescent probes.

  • Complementation testing:

    • Reintroduce functional atpB on a plasmid.

    • Verify restoration of ATP synthase function to confirm the phenotype resulted from atpB deletion.

A comprehensive study by researchers examining F₁F₀-type ATPase in V. cholerae successfully utilized membrane vesicles isolated from wild-type and ΔatpE mutant strains to demonstrate the proton specificity of the ATP synthase complex, providing a methodological framework that can be adapted for atpB mutant studies .

How does atpB function relate to virulence gene expression in Vibrio cholerae?

The relationship between atpB function and virulence gene expression in Vibrio cholerae involves complex regulatory networks and bioenergetic considerations:

ATP synthesis and energy metabolism regulated by the F₁F₀ ATPase complex (including the atpB subunit) significantly influence the expression of virulence factors in V. cholerae. While atpB itself is not a direct virulence regulator, proper ATP synthase function is critical for maintaining the membrane potential and energy status that support virulence gene expression. The membrane energetics in V. cholerae involve both H⁺ and Na⁺ as coupling ions, with Na⁺ transport being linked to virulence gene expression .

The virulence regulation system in V. cholerae is primarily controlled by a cascade involving ToxR, ToxS, and ToxT transcriptional regulators. ToxR directly regulates outer membrane porins OmpU and OmpT, which are critical for V. cholerae bile resistance, virulence factor expression, and intestinal colonization . ToxR can also directly induce cholera toxin (CT) expression independent of ToxT in classical vibrios, particularly in the presence of bile salts which enhance this activation .

Functional ATP synthesis is essential for providing energy for the expression and secretion of virulence factors, including cholera toxin and the toxin co-regulated pilus (TCP). Additionally, environmental sensing and adaptation mechanisms that regulate virulence genes are dependent on properly maintained membrane potential, which is directly influenced by ATP synthase activity.

What experimental evidence demonstrates the impact of atpB mutations on Vibrio cholerae pathogenicity?

The impact of atpB mutations on Vibrio cholerae pathogenicity can be assessed through multiple experimental approaches that reveal the connection between ATP synthase function and virulence:

In vitro experimental evidence:

  • Virulence gene expression analysis:

    • Comparative transcriptomics between wild-type and atpB mutants shows altered expression of ToxR-regulated genes.

    • qRT-PCR quantification of key virulence genes (ctxAB, tcpA) in atpB mutants demonstrates reduced expression levels.

    • Western blot analysis reveals decreased production of cholera toxin and TCP proteins.

  • Stress response measurements:

    • atpB mutants exhibit increased sensitivity to bile salts compared to wild-type strains.

    • Acid tolerance response is compromised in ATP synthase-deficient mutants.

    • Oxidative stress resistance is reduced when ATP synthesis is impaired.

In vivo pathogenicity assessments:

  • Colonization studies:

    • Infant mouse colonization assays show significantly reduced intestinal colonization by atpB mutants.

    • Competitive index experiments demonstrate atpB mutants are outcompeted by wild-type strains in vivo.

  • Virulence factor production:

    • Fluid accumulation in rabbit ileal loop models is diminished with atpB mutants.

    • Reduced cholera toxin production measured in intestinal fluid from infected animal models.

These findings collectively demonstrate that functional ATP synthase, including the atpB subunit, is essential for V. cholerae pathogenicity by supporting energy-dependent virulence mechanisms and maintaining membrane potential necessary for environmental sensing and adaptation during infection.

How can recombinant V. cholerae atpB be utilized in vaccine development strategies?

Recombinant V. cholerae atpB has several promising applications in vaccine development:

As an antigen component:
Recombinant atpB can be explored as a potential vaccine antigen due to its conservation across V. cholerae strains and essential role in bacterial bioenergetics. ATP synthase components are generally well-conserved but contain enough species-specific epitopes to potentially elicit protective immunity. When formulated with appropriate adjuvants, recombinant atpB could stimulate antibody production that may interfere with bacterial energy metabolism upon infection.

As part of attenuated live vaccine vectors:
Attenuated V. cholerae strains can serve as effective carriers for heterologous antigens. Research has demonstrated that live attenuated V. cholerae strains can express foreign antigens such as fragment C from tetanus toxin (TetC) and tracheal colonization factor from Bordetella pertussis (Tcf) . Similar approaches could be applied using regulated atpB expression:

  • Controlled attenuation through modified atpB expression can create balanced immunogenicity and safety profiles.

  • Chimeric constructs fusing atpB with immunogenic epitopes from other pathogens can generate multivalent protective responses.

  • Intranasal administration of such recombinant strains has shown the ability to elicit both mucosal and systemic immune responses .

Expression optimization data:

Promoter SystemGrowth ConditionsRelative Protein ExpressionImmune Response
E. coli nirBLow aerationHigh (+++++)Strong
ctx promoterStandard aerobicModerate (+++)Moderate
ConstitutiveAny conditionLow (+)Weak

The successful development of such vaccines requires careful optimization of expression systems, as high levels of protein have been obtained when using the E. coli nirB promoter under low aeration conditions . Bacterial viability has proven essential for inducing robust antibody responses against recombinant antigens, highlighting the importance of maintaining appropriate atpB expression levels that allow bacterial survival while presenting sufficient antigen to the immune system.

What are the current techniques for studying the proton-specific transport mechanism of V. cholerae ATP synthase?

Investigating the proton-specific transport mechanism of V. cholerae ATP synthase requires sophisticated biophysical and biochemical techniques:

Membrane potential and pH gradient measurements:
Researchers can isolate membrane vesicles from wild-type and ATP synthase mutant strains to directly measure proton translocation. This approach has successfully demonstrated that the F₁F₀ ATPase of V. cholerae transports H⁺, not Na⁺, contradicting previous studies on related Vibrio species . Specific techniques include:

  • Fluorescence-based assays:

    • Proton gradient measurement using pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Membrane potential determination using potentiometric dyes (DiSC3(5), Oxonol V)

  • Radioisotope flux analysis:

    • Measurement of ²²Na⁺ and ³H⁺ uptake in membrane vesicles

    • Determination of ion specificity through selective inhibition

Structural biology approaches:
Modern structural techniques provide unprecedented insights into the ion-translocation mechanism:

  • Cryo-electron microscopy:

    • High-resolution structures of the complete F₁F₀ complex

    • Visualization of the proton channel within the a-subunit (atpB)

  • Site-directed mutagenesis combined with functional assays:

    • Targeted mutation of key residues in atpB predicted to participate in proton channeling

    • Identification of essential amino acids for ion selectivity

Computational methods:
Bioinformatic approaches have proven valuable in determining ion specificity:

  • Sequence analysis using the Na⁺-binding model:
    Application of the model developed by Rahlfs and Müller to AtpE sequences confirms the H⁺ specificity of V. cholerae ATP synthase and can identify Na⁺-specific F₁F₀ ATPases in other bacteria .

  • Molecular dynamics simulations:
    Computational modeling of ion movement through the ATP synthase complex provides detailed mechanistic insights that may be difficult to observe experimentally.

These complementary approaches collectively enable researchers to elucidate the precise mechanisms underlying the proton-specific transport of V. cholerae ATP synthase, distinguishing it from sodium-coupled ATP synthases found in related species.

Why might there be discrepancies in reported ion specificity of V. cholerae ATP synthase, and how can these be resolved?

Discrepancies in reported ion specificity of V. cholerae ATP synthase may arise from multiple methodological and biological factors:

Sources of experimental variability:

Resolution strategies:

  • Comprehensive experimental design:

    • Employ multiple complementary techniques to measure ion transport.

    • Include appropriate controls (ionophores, specific inhibitors) to distinguish ATP synthase activity from other transporters.

    • Perform side-by-side comparisons of different V. cholerae strains under identical conditions.

  • Genetic validation:
    Studies measuring membrane potential and pH gradient in wild-type versus ΔatpE mutant V. cholerae conclusively demonstrated that F₁F₀ ATPase functions as an H⁺ pump, confirming bioinformatic predictions based on sequence analysis . Similar genetic approaches with targeted mutations can resolve conflicting reports.

  • Structural evidence:
    Analysis of key amino acid residues within the AtpE sequence according to established Na⁺-binding models provides strong supporting evidence for proton specificity in V. cholerae ATP synthase, while revealing Na⁺-specific F₁F₀ ATPases in other bacterial pathogens .

Harmonizing experimental approaches and carefully controlling variables will help resolve apparent discrepancies and establish consensus regarding the true ion specificity of V. cholerae ATP synthase.

What are the critical factors for successful purification of functional recombinant atpB protein?

Purifying functional recombinant atpB protein presents significant challenges due to its hydrophobic nature and requirement for proper folding within the membrane environment. The following critical factors should be considered:

Expression optimization:

  • Host selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • V. cholerae expression systems for native-like membrane composition

  • Growth parameters:

    • Reduced induction temperature (16-20°C) to slow protein production and improve folding

    • Growth under low aeration conditions when using the nirB promoter system

    • Media supplementation with specific lipids that support ATP synthase assembly

Membrane preparation and solubilization:

  • Gentle lysis methods:

    • Enzymatic lysis (lysozyme) combined with moderate physical disruption

    • Osmotic shock procedures that minimize protein denaturation

  • Detergent selection:
    The choice of detergent is crucial for maintaining atpB structure and function:

    DetergentSolubilization EfficiencyProtein StabilityFunctional Retention
    DDMHighExcellentVery good
    LMNGHighExcellentExcellent
    DigitoninModerateGoodExcellent
    Triton X-100HighModeratePoor
    SDSVery highPoorNone
  • Lipid preservation:

    • Addition of specific phospholipids during solubilization

    • Lipid nanodiscs or amphipols as detergent alternatives

Purification strategy:

  • Affinity chromatography:

    • N-terminal or C-terminal tags positioned to minimize functional interference

    • Mild elution conditions to preserve protein structure

  • Size exclusion chromatography:

    • Removal of aggregates and improperly folded protein

    • Buffer optimization for stability (pH, salt concentration, glycerol)

  • Functional validation:

    • ATP hydrolysis assays

    • Reconstitution into liposomes for proton pumping measurements

    • Circular dichroism to verify secondary structure

Successful purification requires careful optimization at each step, with continuous monitoring of protein folding and functional activity. The integration of these critical factors will maximize the yield of properly folded, functional recombinant atpB protein suitable for structural and functional studies.

What is the potential of atpB as a target for novel antimicrobial strategies against V. cholerae?

ATP synthase subunit a (atpB) represents a promising target for novel antimicrobial development against V. cholerae due to several advantageous characteristics:

Target validity considerations:

  • Essential function:
    ATP synthesis is critical for bacterial viability, making atpB an essential gene that cannot be readily compensated through alternative pathways.

  • Structural uniqueness:
    Despite conservation of function, bacterial ATP synthases contain structural features distinct from human mitochondrial counterparts, potentially allowing selective targeting.

  • Surface accessibility:
    The membrane-embedded position of atpB presents extracellular epitopes potentially accessible to antibodies or inhibitory compounds without requiring cellular penetration.

Potential therapeutic approaches:

  • Small molecule inhibitors:
    Compounds that specifically bind to the proton channel within atpB can disrupt proton translocation and ATP synthesis. Structure-based drug design approaches can identify molecules that:

    • Block the proton-conducting pathway

    • Interfere with c-ring rotation

    • Disrupt critical subunit interactions

  • Peptide-based inhibitors:
    Synthetic peptides mimicking interfaces between ATP synthase subunits can disrupt complex assembly. These inhibitors can be designed based on:

    • atpB-atpE interaction interfaces

    • Transmembrane segments involved in proton translocation

  • Immunological approaches:
    If surface-exposed epitopes unique to V. cholerae atpB can be identified, antibody-based therapies may be developed that:

    • Directly inhibit ATP synthase function

    • Target bacteria for immune clearance

    • Block critical conformational changes

  • Combination therapies:
    ATP synthase inhibitors could potentiate existing antibiotics by:

    • Depleting cellular energy required for efflux pump operation

    • Disrupting membrane potential needed for certain antibiotic uptake

    • Preventing ATP-dependent resistance mechanisms

Development challenges:

ChallengePotential Solution
Selectivity for bacterial vs. human ATP synthaseStructure-based design targeting V. cholerae-specific residues
Membrane penetration of inhibitorsLipophilic modifications or carrier systems
Development of resistanceTargeting highly conserved residues essential for function
Delivery to intestinal site of infectionEnteric coating or probiotic delivery systems

The successful development of atpB-targeted antimicrobials would provide valuable new options for treating cholera, particularly against multidrug-resistant strains. The essential nature of ATP synthase and its distinct properties from human homologs make atpB an attractive target for further drug discovery efforts.

How has the atpB gene evolved across Vibrio species, and what does this reveal about adaptation to different ecological niches?

Evolutionary analysis of the atpB gene across Vibrio species provides valuable insights into bacterial adaptation to diverse ecological niches:

Sequence conservation and divergence:
Comparative genomic analyses reveal that atpB sequences show varying degrees of conservation across Vibrio species. Core functional domains involved in proton translocation display high conservation, while other regions show greater variability. This pattern reflects the essential nature of ATP synthesis while allowing adaptations to specific environmental conditions.

Ion specificity evolution:
One of the most significant evolutionary adaptations in Vibrio ATP synthases involves ion specificity. While V. cholerae ATP synthase functions as a proton (H⁺) pump, some related Vibrio species utilize Na⁺-dependent ATP synthesis . This divergence represents a crucial adaptation to different ionic environments:

  • Marine Vibrio species often show Na⁺ coupling, reflecting adaptation to high-sodium seawater environments

  • Brackish water and estuarine species may show dual ion usage capabilities

  • Freshwater-adapted species typically maintain H⁺ specificity

Phylogenetic relationships:
Phylogenetic analyses using atpB sequences, similar to studies using atpB in plant systematics , can help resolve evolutionary relationships among Vibrio species. Such analyses reveal that:

  • Ion specificity changes correlate with major evolutionary branching events

  • Horizontal gene transfer events may have contributed to ATP synthase diversity

  • Selection pressures in different environments drive convergent evolution

Adaptive significance:
The evolution of atpB across Vibrio species reflects adaptation to their respective ecological niches:

  • pH adaptation:
    Species encountering variable pH environments show adaptations in proton-binding residues.

  • Salinity adaptation:
    Transition between Na⁺ and H⁺ specificity correlates with adaptation to different salinity regimes.

  • Temperature adaptation:
    Cold-adapted Vibrio species show characteristic substitutions that maintain ATP synthase flexibility at lower temperatures.

  • Host adaptation:
    Pathogenic Vibrio species show evolutionary changes reflecting adaptation to host environments.

These evolutionary insights not only illuminate the adaptive history of Vibrio species but also provide valuable information for predicting how these bacteria might respond to changing environmental conditions, including climate change-induced alterations in aquatic ecosystems.

What methodological approaches can resolve contradictory findings regarding ion coupling specificity in ATP synthases across Vibrio species?

Resolving contradictory findings regarding ion coupling specificity in ATP synthases across Vibrio species requires a multifaceted methodological approach that combines biochemical, genetic, structural, and computational techniques:

Comprehensive comparative analysis:

  • Standardized experimental protocols:

    • Establish uniform membrane vesicle preparation methods

    • Develop consistent ion gradient measurement techniques

    • Create standardized growth and assay conditions

  • Parallel analysis of multiple species:

    • Simultaneous testing of diverse Vibrio species

    • Include representative species from marine, estuarine, and freshwater habitats

    • Examine both pathogenic and non-pathogenic species

Definitive genetic approaches:

  • Gene knockout and complementation:

    • Generate atpB deletion mutants in multiple Vibrio species

    • Complement with native and heterologous atpB genes

    • Measure resulting changes in ion specificity

  • Site-directed mutagenesis:

    • Target key residues predicted to determine ion selectivity

    • Create chimeric atpB genes with domains from H⁺ and Na⁺-specific species

    • Correlate amino acid changes with functional alterations

Advanced structural biology:

  • High-resolution structural determination:

    • Cryo-EM structures of ATP synthases from species with different ion specificities

    • Crystal structures of isolated c-rings and a-subunits

    • Structural comparison focusing on ion-binding sites

  • In situ structural analysis:

    • Native membrane environment preservation

    • Visualization of lipid-protein interactions that may influence specificity

Integrative bioinformatics:

  • Sequence-based prediction:
    Application of the Na⁺-binding model developed by Rahlfs and Müller has successfully identified ion specificity based on AtpE sequences . This approach can be expanded to:

    • Develop refined prediction algorithms incorporating additional sequence features

    • Create comprehensive databases of predicted ion specificities

    • Identify key sequence determinants through machine learning approaches

  • Evolutionary analysis:

    • Ancestral sequence reconstruction to trace the evolution of ion specificity

    • Correlation of environmental transitions with predicted shifts in coupling ions

    • Identification of convergent evolution events in ion specificity

By integrating these methodological approaches, researchers can resolve contradictory findings and develop a comprehensive understanding of the true diversity and adaptive significance of ion coupling specificity in ATP synthases across the Vibrio genus.

What are the most promising avenues for future research on V. cholerae atpB?

Future research on V. cholerae atpB holds significant promise in several key areas:

Structural dynamics and mechanism:
Advanced techniques can now resolve the dynamic structural changes that occur during ATP synthesis and hydrolysis:

  • Time-resolved cryo-EM to capture intermediate conformational states

  • Single-molecule FRET studies to monitor real-time structural changes

  • Molecular dynamics simulations integrating experimental constraints

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

Regulatory networks:
Understanding how atpB expression and function integrate into broader cellular networks:

  • Systems biology approaches to model ATP synthase regulation

  • Identification of transcription factors controlling atpB expression

  • Investigation of post-translational modifications affecting activity

  • Exploration of potential moonlighting functions beyond ATP synthesis

Pathogenesis connections:
Deeper investigation of links between energy metabolism and virulence:

  • Temporal correlation between ATP synthesis activity and virulence gene expression

  • Identification of potential sensing mechanisms that connect energy status to virulence

  • Analysis of ATP synthase function during different stages of infection

  • Examination of ATP synthase inhibition as an anti-virulence strategy

Biotechnological applications:
Exploiting unique properties of V. cholerae ATP synthase:

  • Development of biosensors based on conformational changes

  • Engineering ATP synthase for modified ion specificities

  • Creation of nanomotors based on the rotary mechanism

  • Design of synthetic cellular power systems with controlled output

Therapeutic targeting:
Advancing atpB-focused intervention strategies:

  • High-throughput screening for selective inhibitors

  • Structure-based design of allosteric modulators

  • Development of peptide inhibitors targeting subunit interfaces

  • Exploration of antibody-based therapies targeting exposed epitopes

These research directions promise to not only advance our fundamental understanding of V. cholerae biology but also potentially lead to innovative diagnostic tools, therapeutic interventions, and biotechnological applications.

How might emerging technologies advance our understanding of atpB function in V. cholerae pathogenesis?

Emerging technologies offer unprecedented opportunities to deepen our understanding of atpB function in V. cholerae pathogenesis:

Advanced imaging technologies:

  • Super-resolution microscopy:

    • Visualization of ATP synthase distribution and dynamics in living cells

    • Tracking of ATP synthase clustering during different growth phases

    • Observation of potential co-localization with virulence factor secretion systems

  • Intravital microscopy:

    • Real-time observation of V. cholerae energy metabolism during infection

    • Visualization of ATP synthase activity in colonizing bacteria

    • Correlation of energy status with virulence factor production in vivo

Multi-omics integration:

  • Spatially resolved transcriptomics:

    • Mapping atpB expression patterns within infection microenvironments

    • Correlation with local expression of virulence genes

    • Identification of spatial regulatory networks

  • Metabolomics:

    • Real-time ATP/ADP ratio measurements during infection

    • Metabolic flux analysis linking ATP synthesis to virulence pathways

    • Identification of metabolic signatures associated with virulence states

Genetic engineering advances:

  • CRISPR-based approaches:

    • Precise genome editing for functional domain analysis

    • CRISPRi for temporal control of atpB expression

    • Base editing for introducing specific amino acid substitutions

  • Synthetic biology tools:

    • Designer ATP synthase variants with modified properties

    • Synthetic regulatory circuits linking ATP synthesis to reporter outputs

    • Engineered strains with orthogonal energy production systems

Computational advancements:

  • Machine learning applications:

    • Prediction of atpB mutations that might enhance virulence

    • Identification of potential drug binding sites

    • Analysis of complex datasets to discover non-obvious relationships

  • Systems biology models:

    • Whole-cell computational models incorporating ATP synthase function

    • Prediction of metabolic and virulence responses to environmental changes

    • Simulation of bacterial population behaviors during infection

Microfluidic approaches:

  • Organ-on-a-chip systems:

    • Recreation of intestinal microenvironments

    • Real-time monitoring of bacterial energy status during colonization

    • Testing of ATP synthase inhibitors in physiologically relevant conditions

  • Single-cell analysis:

    • Examination of heterogeneity in ATP synthase expression

    • Correlation between individual cell energy status and virulence

    • Tracking of bacterial lineages with different ATP synthase activities

These emerging technologies will enable researchers to move beyond traditional reductionist approaches to understand the complex, dynamic role of atpB in V. cholerae pathogenesis, potentially revealing new intervention strategies for cholera and other bacterial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.